KEGG   Legionella longbeachae: LLO_1156Help
Entry
LLO_1156          CDS       T01183                                 

Gene name
ruvA
Definition
holliday junction DNA helicase (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
llo  Legionella longbeachae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:llo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LLO_1156 (ruvA)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LLO_1156 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1364488..1365084
Genome map
AA seq 198 aa AA seqDB search
MIGWLDGHIVDKYQPGKLVLNVHGVGYDVETSLNTFFKLDTLNGSVGLHIHTIVREDALL
LYGFLDRQERELFRALIKVNGVGPKLAMSILSSITPNEFIECIQQENAVFLMKLPGIGKK
TAERLVVEMRDSLKQFSVPCSESLKSDHRMSDQDEAVSALEVLGYKPQEALKAVKKVNDG
VKSCEQLIRDALQVLAAR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattggttggttggatgggcacattgttgataaatatcagccaggaaaattagttctc
aatgttcatggagttggatatgatgtggaaacctcgttaaataccttttttaaattagat
acgctaaatggatcagtgggcctgcatatacataccatcgttcgcgaagatgcattgctt
ttatatggttttttagatcgtcaggaaagagaattatttagggcattaattaaagtaaat
ggagtaggcccaaagcttgctatgtctattctctcgagtatcaccccaaatgagttcatt
gaatgcattcaacaggaaaatgctgtttttttaatgaagttaccagggataggtaagaaa
acagccgaacggttggtagtagaaatgcgtgatagcttaaaacaattttctgtgccttgt
tctgaatctttgaagtcggatcataggatgagtgatcaggatgaagcagtaagtgcttta
gaagtattggggtataagcctcaagaggcattgaaagctgtgaagaaagttaatgatggg
gtaaaaagttgtgaacagttaattcgggacgctctgcaagtgttagcagcgcgataa

DBGET integrated database retrieval system