KEGG   Legionella longbeachae: LLO_1173Help
Entry
LLO_1173          CDS       T01183                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
llo  Legionella longbeachae
Pathway
llo00260  Glycine, serine and threonine metabolism
llo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01130  Biosynthesis of antibiotics
llo01230  Biosynthesis of amino acids
Module
llo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLO_1173 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLO_1173 (trpB)
Enzymes [BR:llo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLO_1173 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBJ11530
Pasteur: llo1173
UniProt: D3HRK2
Position
1384750..1385949
Genome map
AA seq 399 aa AA seqDB search
MNKKELPDERGHFGPYGGIFVADTLMHALKELEEAYAKYRQDPDFLAELHAELKDYVGRP
NPLYHARRLSQEIGGAQIYLKREDLNHTGAHKINNTVGQALLAKRMGKTRVIAETGAGQH
GVASATVAAKLGLECVVYMGAEDIKRQASNVYRMKLLGAEVVPVTAGSRTLKDALNEAMR
DWVSHIDDTFYIIGTVAGPHPYPQMVRDFQSVIGIEAKAQILEKTGRLPDALVACVGGGS
NAIGLFYPFLNDTAVALYGVEAGGKGLDSGEHSASLIAGIPGVLHGNRTYLLCDEHGQIK
DTHSISAGLDYPGVGPEHAYLKDTGRAIYEAINDDEALHAFRTLTRIEGIIPALESSHAI
AYAMKLAKTMPVNQNIIVNLSGRGDKDMHTVAQIDGISV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaagaacttcctgatgaacgtgggcatttcggtccttatggcggtattttt
gtagcggatacgttgatgcatgctttgaaagagttggaagaggcctacgcaaaataccga
caagatcctgattttctcgcagaattgcatgctgaattaaaggattatgtaggacggcct
aatccactgtatcatgctcgacgcctaagccaggaaatcggtggcgcacaaatctaccta
aagcgagaagatttgaatcacactggagcccacaaaattaataacactgtgggacaagca
ttactcgctaagcggatgggaaaaacccgagtcattgctgaaacaggagcaggacaacac
ggggtggcttcagctactgtcgctgctaaattaggcttggagtgcgtggtttatatggga
gctgaagacataaaacgccaagcatctaatgtgtaccgcatgaaattgctgggtgcggag
gttgttcctgtaacagcaggatcacgtacgttgaaagatgcattgaatgaagccatgcgg
gattgggtgagccatattgatgatacattttatatcattggaacagttgcaggaccacac
ccttatcctcaaatggttagagattttcaatcagtaattggtattgaagcaaaagcacag
attttagaaaaaacaggccgtttgccggatgctttagttgcttgtgtaggtggaggttct
aatgcgattggcttattttatccttttctgaatgatacagcagttgctctttatggtgtg
gaagcaggaggaaaaggtttggatagtggcgaacattccgcctcgcttatagccggaata
ccaggtgttttacatggtaatcgaacttatttgctttgtgatgaacacggtcaaattaag
gacactcactcgatttctgcaggtcttgactatcctggtgtagggcctgaacacgcttat
ttgaaggatactgggcgcgcgatttatgaggcaattaatgatgatgaagcgttgcatgcg
tttcgaaccttaacccgtatcgaaggcattattcctgcacttgaatccagtcatgctatt
gcctatgcaatgaaacttgcgaagacaatgcccgtaaatcaaaatattatcgtgaattta
tcggggcgtggcgataaagacatgcatacagtggcacaaattgatggaattagcgtatga

DBGET integrated database retrieval system