KEGG   Legionella longbeachae: LLO_1173Help
Entry
LLO_1173          CDS       T01183                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
llo  Legionella longbeachae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LLO_1173 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLO_1173 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLO_1173 (trpB)
Enzymes [BR:llo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLO_1173 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1384750..1385949
Genome map
AA seq 399 aa AA seqDB search
MNKKELPDERGHFGPYGGIFVADTLMHALKELEEAYAKYRQDPDFLAELHAELKDYVGRP
NPLYHARRLSQEIGGAQIYLKREDLNHTGAHKINNTVGQALLAKRMGKTRVIAETGAGQH
GVASATVAAKLGLECVVYMGAEDIKRQASNVYRMKLLGAEVVPVTAGSRTLKDALNEAMR
DWVSHIDDTFYIIGTVAGPHPYPQMVRDFQSVIGIEAKAQILEKTGRLPDALVACVGGGS
NAIGLFYPFLNDTAVALYGVEAGGKGLDSGEHSASLIAGIPGVLHGNRTYLLCDEHGQIK
DTHSISAGLDYPGVGPEHAYLKDTGRAIYEAINDDEALHAFRTLTRIEGIIPALESSHAI
AYAMKLAKTMPVNQNIIVNLSGRGDKDMHTVAQIDGISV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaagaacttcctgatgaacgtgggcatttcggtccttatggcggtattttt
gtagcggatacgttgatgcatgctttgaaagagttggaagaggcctacgcaaaataccga
caagatcctgattttctcgcagaattgcatgctgaattaaaggattatgtaggacggcct
aatccactgtatcatgctcgacgcctaagccaggaaatcggtggcgcacaaatctaccta
aagcgagaagatttgaatcacactggagcccacaaaattaataacactgtgggacaagca
ttactcgctaagcggatgggaaaaacccgagtcattgctgaaacaggagcaggacaacac
ggggtggcttcagctactgtcgctgctaaattaggcttggagtgcgtggtttatatggga
gctgaagacataaaacgccaagcatctaatgtgtaccgcatgaaattgctgggtgcggag
gttgttcctgtaacagcaggatcacgtacgttgaaagatgcattgaatgaagccatgcgg
gattgggtgagccatattgatgatacattttatatcattggaacagttgcaggaccacac
ccttatcctcaaatggttagagattttcaatcagtaattggtattgaagcaaaagcacag
attttagaaaaaacaggccgtttgccggatgctttagttgcttgtgtaggtggaggttct
aatgcgattggcttattttatccttttctgaatgatacagcagttgctctttatggtgtg
gaagcaggaggaaaaggtttggatagtggcgaacattccgcctcgcttatagccggaata
ccaggtgttttacatggtaatcgaacttatttgctttgtgatgaacacggtcaaattaag
gacactcactcgatttctgcaggtcttgactatcctggtgtagggcctgaacacgcttat
ttgaaggatactgggcgcgcgatttatgaggcaattaatgatgatgaagcgttgcatgcg
tttcgaaccttaacccgtatcgaaggcattattcctgcacttgaatccagtcatgctatt
gcctatgcaatgaaacttgcgaagacaatgcccgtaaatcaaaatattatcgtgaattta
tcggggcgtggcgataaagacatgcatacagtggcacaaattgatggaattagcgtatga

DBGET integrated database retrieval system