KEGG   Legionella longbeachae: LLO_1174Help
Entry
LLO_1174          CDS       T01183                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
llo  Legionella longbeachae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LLO_1174 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLO_1174 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLO_1174 (trpA)
Enzymes [BR:llo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLO_1174 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1385946..1386755
Genome map
AA seq 269 aa AA seqDB search
MNRIDSTLMRLKAKGKKMLSPYITAGDPYPEVTVNLMHELVRAGADILELGIPFSDPMAE
GPVIQRAMERALAQDVHCHTVLNMVKEFRVQDQETPVIVMGYLNPIEHFGYELFAQQAAE
AGIDGTIIVDLPPEESEEIAKIWQKYGLYSIFLCSPTTSDERMALINKFANGYLYYVSLK
GVTGSDALDTASLKAQYLHRKTQTSLPLMVGFGIKTAEMAAEIARFADGIIVGAALITRI
LDAYNTNNDMLQAGADLIYSMRHAMDNNG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaattgacagcaccttgatgcgccttaaggcaaaaggtaaaaaaatgctcagt
ccttatatcacagctggagatccttatcctgaggtcactgtgaatttaatgcatgaatta
gtgagagcgggagcagatattttagaattaggtatacctttttccgatcctatggctgaa
ggaccagtgattcaacgcgctatggagcgtgcacttgctcaagacgtgcactgccatact
gtattaaatatggtcaaagaatttcgtgttcaggatcaagaaaccccggtgattgtcatg
ggttatttaaatcctatagagcattttggctatgagctttttgcacaacaagcagcagaa
gcaggtattgatggaaccataatagtagatttacctcctgaggaaagcgaagaaattgct
aaaatctggcaaaaatatggtttgtacagtatctttctttgctcgcctacaacttcagac
gagcgtatggccttaataaataagtttgctaatggctatttatactatgtgtctttaaaa
ggcgtcactgggtctgatgcacttgatacagcatctttaaaagcccaatatttacaccga
aaaactcaaaccagtcttcctttaatggtaggttttggcataaaaacagcagaaatggca
gcagaaatagctcgttttgctgatggtattattgtaggggctgctttaattacgcgcata
cttgatgcttataatacgaataatgatatgttacaagccggagctgatttaatttattcc
atgcgacatgctatggacaataatggataa

DBGET integrated database retrieval system