KEGG   Legionella longbeachae: LLO_1234Help
Entry
LLO_1234          CDS       T01183                                 

Gene name
pfp
Definition
PPi dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLO_1234 (pfp)
   01230 Biosynthesis of amino acids
    LLO_1234 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_1234 (pfp)
   00030 Pentose phosphate pathway
    LLO_1234 (pfp)
   00051 Fructose and mannose metabolism
    LLO_1234 (pfp)
   00052 Galactose metabolism
    LLO_1234 (pfp)
  Energy metabolism
   00680 Methane metabolism
    LLO_1234 (pfp)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LLO_1234 (pfp)
Enzymes [BR:llo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LLO_1234 (pfp)
Protein phosphatases and associated proteins [BR:llo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LLO_1234 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1458661..1459905)
Genome map
AA seq 414 aa AA seqDB search
MTIKNAIYAQSGGVTAVINASACAVIQTAKLYPQHIGKVYAAKNGIIGALNEELIDTSLE
SDADIAKLLQTPSGAFGSCRYKLKNDGAEYERLIEVFKAHNIGYFFYNGGGDSQDTAYKV
SQLGANMGYPITCIGIPKTVDNDLPFTDACPGFGSVAKYVAVSTREAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLASQNPEEPPHIILLPEVAFEPARFLSKVDECVKTYGYCVV
VVSEGIRNTEGKFLSDAGLKDAFGHAQLGGVAPVLAQLIKTELNYKYHWAVADYLQRAAR
HIASKVDLEQAYALGKAAVEFAVKGYNAVMPIIVREQDEPYQWSIGHAALADVANQEKAL
PKEYIAADGMGITEACKRYLSPLIQGEAYPDYVNGLPDYVRLKNKLVPKVLQGK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaaatgcgatatatgctcaatcaggaggtgtcacggcggtcattaatgcc
tccgcttgtgcagttatccaaacagctaaactctatcctcaacacataggaaaggtctat
gctgccaaaaatggaatcatcggggcattaaatgaagagcttattgacacatcactggaa
agtgacgcagatatagctaagttattacaaaccccttccggtgcttttggttcttgccgt
tacaaactaaaaaatgacggggctgaatatgagcgactcattgaagtatttaaagcacat
aatataggttattttttctataacgggggtggtgactcccaggatactgcctataaagta
tcacaattgggtgccaatatgggttatcccatcacctgtattggcataccaaaaactgta
gataatgatcttccttttacagatgcatgtccaggttttggttccgtagcgaaatatgtt
gccgtatctactcgagaggcagggttcgacgttgcctctatggctgcctcatcaacaaaa
gtttttattctcgaagtcatgggacgacatgcaggatggattgcagcagcaagtggttta
gccagccaaaatcctgaagagccaccccatattattttgttacctgaagtcgcctttgag
ccagcaaggtttttgagcaaagtagatgaatgcgtcaaaacttatggatattgcgttgtt
gttgtttcagaaggaattcgaaatacagaaggtaagtttttaagtgatgcaggattaaaa
gatgcctttggacatgcccaattaggaggcgttgccccagttcttgctcaactcattaaa
accgagcttaattataaataccactgggcagttgctgattatctacaacgagcagcgcga
catattgcatctaaagttgatttggaacaggcctatgccctaggcaaagccgccgtagaa
tttgccgttaaaggctacaatgctgttatgcccattatcgtacgcgaacaagatgaaccc
tatcaatggtctattggtcatgcagccttggcagatgttgccaatcaagagaaagcttta
cctaaagaatacattgctgctgatggaatgggaatcacagaagcatgcaaacgctatttg
tcgccattgattcaaggcgaagcttatcctgattatgtaaatggacttcctgattatgtt
cgtttaaaaaataaattagtacccaaagtacttcaaggcaaatag

DBGET integrated database retrieval system