KEGG   Legionella longbeachae: LLO_1234Help
Entry
LLO_1234          CDS       T01183                                 

Gene name
pfp
Definition
PPi dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:llo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:llo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:llo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:llo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:llo00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:llo00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:llo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1458661..1459905)
Genome map
AA seq 414 aa AA seqDB search
MTIKNAIYAQSGGVTAVINASACAVIQTAKLYPQHIGKVYAAKNGIIGALNEELIDTSLE
SDADIAKLLQTPSGAFGSCRYKLKNDGAEYERLIEVFKAHNIGYFFYNGGGDSQDTAYKV
SQLGANMGYPITCIGIPKTVDNDLPFTDACPGFGSVAKYVAVSTREAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLASQNPEEPPHIILLPEVAFEPARFLSKVDECVKTYGYCVV
VVSEGIRNTEGKFLSDAGLKDAFGHAQLGGVAPVLAQLIKTELNYKYHWAVADYLQRAAR
HIASKVDLEQAYALGKAAVEFAVKGYNAVMPIIVREQDEPYQWSIGHAALADVANQEKAL
PKEYIAADGMGITEACKRYLSPLIQGEAYPDYVNGLPDYVRLKNKLVPKVLQGK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaaatgcgatatatgctcaatcaggaggtgtcacggcggtcattaatgcc
tccgcttgtgcagttatccaaacagctaaactctatcctcaacacataggaaaggtctat
gctgccaaaaatggaatcatcggggcattaaatgaagagcttattgacacatcactggaa
agtgacgcagatatagctaagttattacaaaccccttccggtgcttttggttcttgccgt
tacaaactaaaaaatgacggggctgaatatgagcgactcattgaagtatttaaagcacat
aatataggttattttttctataacgggggtggtgactcccaggatactgcctataaagta
tcacaattgggtgccaatatgggttatcccatcacctgtattggcataccaaaaactgta
gataatgatcttccttttacagatgcatgtccaggttttggttccgtagcgaaatatgtt
gccgtatctactcgagaggcagggttcgacgttgcctctatggctgcctcatcaacaaaa
gtttttattctcgaagtcatgggacgacatgcaggatggattgcagcagcaagtggttta
gccagccaaaatcctgaagagccaccccatattattttgttacctgaagtcgcctttgag
ccagcaaggtttttgagcaaagtagatgaatgcgtcaaaacttatggatattgcgttgtt
gttgtttcagaaggaattcgaaatacagaaggtaagtttttaagtgatgcaggattaaaa
gatgcctttggacatgcccaattaggaggcgttgccccagttcttgctcaactcattaaa
accgagcttaattataaataccactgggcagttgctgattatctacaacgagcagcgcga
catattgcatctaaagttgatttggaacaggcctatgccctaggcaaagccgccgtagaa
tttgccgttaaaggctacaatgctgttatgcccattatcgtacgcgaacaagatgaaccc
tatcaatggtctattggtcatgcagccttggcagatgttgccaatcaagagaaagcttta
cctaaagaatacattgctgctgatggaatgggaatcacagaagcatgcaaacgctatttg
tcgccattgattcaaggcgaagcttatcctgattatgtaaatggacttcctgattatgtt
cgtttaaaaaataaattagtacccaaagtacttcaaggcaaatag

DBGET integrated database retrieval system