KEGG   Legionella longbeachae: LLO_1234Help
Entry
LLO_1234          CDS       T01183                                 

Gene name
pfp
Definition
(GenBank) putative PPi dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
llo  Legionella longbeachae
Pathway
llo00010  Glycolysis / Gluconeogenesis
llo00030  Pentose phosphate pathway
llo00051  Fructose and mannose metabolism
llo00052  Galactose metabolism
llo00680  Methane metabolism
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_1234 (pfp)
   00030 Pentose phosphate pathway
    LLO_1234 (pfp)
   00051 Fructose and mannose metabolism
    LLO_1234 (pfp)
   00052 Galactose metabolism
    LLO_1234 (pfp)
  Energy metabolism
   00680 Methane metabolism
    LLO_1234 (pfp)
Enzymes [BR:llo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LLO_1234 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     LLO_1234 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Cadherin_C BSP
Motif
Other DBs
NCBI-ProteinID: CBJ11593
Pasteur: llo1234
UniProt: D3HRR4
Position
complement(1458661..1459905)
Genome map
AA seq 414 aa AA seqDB search
MTIKNAIYAQSGGVTAVINASACAVIQTAKLYPQHIGKVYAAKNGIIGALNEELIDTSLE
SDADIAKLLQTPSGAFGSCRYKLKNDGAEYERLIEVFKAHNIGYFFYNGGGDSQDTAYKV
SQLGANMGYPITCIGIPKTVDNDLPFTDACPGFGSVAKYVAVSTREAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLASQNPEEPPHIILLPEVAFEPARFLSKVDECVKTYGYCVV
VVSEGIRNTEGKFLSDAGLKDAFGHAQLGGVAPVLAQLIKTELNYKYHWAVADYLQRAAR
HIASKVDLEQAYALGKAAVEFAVKGYNAVMPIIVREQDEPYQWSIGHAALADVANQEKAL
PKEYIAADGMGITEACKRYLSPLIQGEAYPDYVNGLPDYVRLKNKLVPKVLQGK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaaatgcgatatatgctcaatcaggaggtgtcacggcggtcattaatgcc
tccgcttgtgcagttatccaaacagctaaactctatcctcaacacataggaaaggtctat
gctgccaaaaatggaatcatcggggcattaaatgaagagcttattgacacatcactggaa
agtgacgcagatatagctaagttattacaaaccccttccggtgcttttggttcttgccgt
tacaaactaaaaaatgacggggctgaatatgagcgactcattgaagtatttaaagcacat
aatataggttattttttctataacgggggtggtgactcccaggatactgcctataaagta
tcacaattgggtgccaatatgggttatcccatcacctgtattggcataccaaaaactgta
gataatgatcttccttttacagatgcatgtccaggttttggttccgtagcgaaatatgtt
gccgtatctactcgagaggcagggttcgacgttgcctctatggctgcctcatcaacaaaa
gtttttattctcgaagtcatgggacgacatgcaggatggattgcagcagcaagtggttta
gccagccaaaatcctgaagagccaccccatattattttgttacctgaagtcgcctttgag
ccagcaaggtttttgagcaaagtagatgaatgcgtcaaaacttatggatattgcgttgtt
gttgtttcagaaggaattcgaaatacagaaggtaagtttttaagtgatgcaggattaaaa
gatgcctttggacatgcccaattaggaggcgttgccccagttcttgctcaactcattaaa
accgagcttaattataaataccactgggcagttgctgattatctacaacgagcagcgcga
catattgcatctaaagttgatttggaacaggcctatgccctaggcaaagccgccgtagaa
tttgccgttaaaggctacaatgctgttatgcccattatcgtacgcgaacaagatgaaccc
tatcaatggtctattggtcatgcagccttggcagatgttgccaatcaagagaaagcttta
cctaaagaatacattgctgctgatggaatgggaatcacagaagcatgcaaacgctatttg
tcgccattgattcaaggcgaagcttatcctgattatgtaaatggacttcctgattatgtt
cgtttaaaaaataaattagtacccaaagtacttcaaggcaaatag

DBGET integrated database retrieval system