KEGG   Legionella longbeachae: LLO_1320Help
Entry
LLO_1320          CDS       T01183                                 

Gene name
DWF
Definition
(GenBank) 7-dehydrocholesterol reductase (7-DHC reductase) (Sterol Delta(7)-reductase) (Protein DWARF 5)
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
llo  Legionella longbeachae
Pathway
llo00100  Steroid biosynthesis
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    LLO_1320 (DWF)
Enzymes [BR:llo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     LLO_1320 (DWF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ERG4_ERG24
Motif
Other DBs
NCBI-ProteinID: CBJ11680
Pasteur: llo1320
UniProt: D3HS01
Position
1566209..1567507
Genome map
AA seq 432 aa AA seqDB search
MMNFNIRNTLGPLFLILVCPVFVMLMWYTNTQLEGSLLALWNLMLQNGFSQSIYSIWQPY
FWGSTIAWKIIVVFIVFELALMRLLPGKIFHGPISPKGNVPVYKDNGLFAFIVTMGTFCV
SSFGFNLFSASILYDNLGALLGALNIFSLIFCAFLYLKGRFFPSSTDSGITRNFLFDYYW
GTELYPQVFGWHIKKFITCRFGMMSWGLFLISYCAKQAELGGVSNSMLISVFLQFVYLSK
FYMWEKGYLRSLDMMHDRAGFYICWGCMVWVPCVYTSPSMYLVLHPIHLPFIWAIVILFL
GFASIMINFLADRQRLTARATQGDCSIWGKKPVTVLAHYKTTEGDKKQTILLASGWWGVA
RHFHYIPELAGTFFWSVPALFVNFSPYFYLSFLTVLLFDRAFRDDRRCATKYGQDWKKYC
ELVPYKIVPFLI
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttcaatattcggaatactttaggtccgttatttctgattcttgtatgccct
gtttttgtgatgttaatgtggtataccaatacccagcttgagggatctttgttggcgtta
tggaatttgatgctccaaaatgggttttcacaatcgatttattcaatatggcaaccttat
ttttggggttcaacaatcgcctggaaaatcattgtcgtatttattgtatttgaattggcg
ttaatgcgattacttccaggaaaaatatttcatgggccgatttctccaaaaggaaatgta
cctgtttataaagacaatggcctttttgcatttatagtgactatgggaacattttgtgtt
tcttcctttggttttaatttattttcggcttctattctctatgataatcttggcgctctt
ttgggagcacttaatatatttagtcttatattctgcgcttttttgtatctaaagggacgt
ttttttccttcatctactgattcaggtatcaccaggaattttttgtttgattattattgg
ggtacggaactctatcctcaagtatttgggtggcatattaagaaattcatcacttgtcgt
tttggaatgatgagctggggtttatttttgatttcttattgtgcaaagcaggcagaatta
ggtggtgtatcaaactcgatgcttatttctgttttcctgcaattcgtttatctaagcaaa
ttttatatgtgggaaaaaggatatttgcgttccttagatatgatgcatgatcgcgctggt
ttttatatttgttggggatgcatggtatgggttccttgtgtttatacttcaccaagcatg
tatcttgttcttcatcccattcatttaccttttatttgggcaatagttattttatttctg
ggttttgcatccattatgatcaattttcttgcagacaggcaaagattgactgctagggca
actcaaggtgattgttcaatatggggtaaaaagcctgttactgtattagcccattataaa
actacagagggtgacaaaaaacaaactatattgcttgcttcaggatggtggggggttgcc
aggcattttcattacattccggaacttgccggaacattcttttggtctgtgcctgctttg
tttgtgaatttctcaccgtatttttatctcagttttttaacagtacttttatttgatagg
gctttccgtgacgatagacgctgtgcgactaaatatggtcaggattggaagaaatactgc
gagcttgttccgtataagattgttccctttctaatttaa

DBGET integrated database retrieval system