KEGG   Legionella longbeachae: LLO_1453Help
Entry
LLO_1453          CDS       T01183                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
llo  Legionella longbeachae
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:llo00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1726414..1727316
Genome map
AA seq 300 aa AA seqDB search
MWNLSSRVHLLNHFPEDGVVCYVKRDDELSCGISGSKLRKYASLFPFLIEQKIRHLIIIA
GPQSNNLLSVLQLAREFQFKVTAFLIQPWKLELQGNYKLSRLFLEEEDIVWVSRDSWTQV
NELAINYLKTLNEPGFVLFEGASVSEAMPGAATLAEDIIFNERTLKLIFQHIFIDAGTGF
SASALISRLAELNHQAQIHVLLLADDEELFYSKLNQWIGLIPKNFNCFYPTTAKAFGSVN
QTIKNEVLRLAKEEGILADPIYAAKLFYESRKRIQIKRLKGNVLIIHSGGTLSMPAFDYI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatttatccagcagagtacatcttttaaatcactttcctgaagacggcgtagtt
tgttatgtcaaaagggatgatgagttaagttgcggtattagcggttcaaaattacgcaaa
tacgccagtttgtttccttttttgatagagcagaaaatacgtcatttaattattattgcc
ggccctcaatctaataatttactttccgtattacagctcgcacgagagtttcaattcaaa
gtgaccgcttttttgattcagccttggaaattagagttacaaggaaattataaattaagc
cgcctttttcttgaagaagaagatattgtatgggttagtcgtgatagttggactcaagta
aatgaactcgctattaattatctaaagacgcttaatgaaccaggttttgtattattcgaa
ggggccagcgtttctgaagcaatgccgggtgcggctactttagcggaagatattattttc
aatgaacgcaccttaaaattaatatttcagcatatttttatagatgctggaacgggattt
tctgcgtccgccctcattagcaggctcgctgaattaaaccatcaggcgcaaattcatgta
cttttattggctgatgatgaagaactattttacagcaaattaaatcaatggattggatta
attcctaaaaatttcaattgtttttatccaacaacggccaaagcatttggatctgtgaat
caaacgatcaagaatgaagtactgcgtttagcaaaagaggaggggattttggcggatcct
atttatgcggctaaattattttatgagtcaagaaaacgtatccaaataaaacgattaaaa
ggaaatgtattgattattcattccggaggaaccttgagtatgcccgcatttgattatatt
taa

DBGET integrated database retrieval system