KEGG   Legionella longbeachae: LLO_1453Help
Entry
LLO_1453          CDS       T01183                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
llo  Legionella longbeachae
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LLO_1453
Enzymes [BR:llo01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     LLO_1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1726414..1727316
Genome map
AA seq 300 aa AA seqDB search
MWNLSSRVHLLNHFPEDGVVCYVKRDDELSCGISGSKLRKYASLFPFLIEQKIRHLIIIA
GPQSNNLLSVLQLAREFQFKVTAFLIQPWKLELQGNYKLSRLFLEEEDIVWVSRDSWTQV
NELAINYLKTLNEPGFVLFEGASVSEAMPGAATLAEDIIFNERTLKLIFQHIFIDAGTGF
SASALISRLAELNHQAQIHVLLLADDEELFYSKLNQWIGLIPKNFNCFYPTTAKAFGSVN
QTIKNEVLRLAKEEGILADPIYAAKLFYESRKRIQIKRLKGNVLIIHSGGTLSMPAFDYI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatttatccagcagagtacatcttttaaatcactttcctgaagacggcgtagtt
tgttatgtcaaaagggatgatgagttaagttgcggtattagcggttcaaaattacgcaaa
tacgccagtttgtttccttttttgatagagcagaaaatacgtcatttaattattattgcc
ggccctcaatctaataatttactttccgtattacagctcgcacgagagtttcaattcaaa
gtgaccgcttttttgattcagccttggaaattagagttacaaggaaattataaattaagc
cgcctttttcttgaagaagaagatattgtatgggttagtcgtgatagttggactcaagta
aatgaactcgctattaattatctaaagacgcttaatgaaccaggttttgtattattcgaa
ggggccagcgtttctgaagcaatgccgggtgcggctactttagcggaagatattattttc
aatgaacgcaccttaaaattaatatttcagcatatttttatagatgctggaacgggattt
tctgcgtccgccctcattagcaggctcgctgaattaaaccatcaggcgcaaattcatgta
cttttattggctgatgatgaagaactattttacagcaaattaaatcaatggattggatta
attcctaaaaatttcaattgtttttatccaacaacggccaaagcatttggatctgtgaat
caaacgatcaagaatgaagtactgcgtttagcaaaagaggaggggattttggcggatcct
atttatgcggctaaattattttatgagtcaagaaaacgtatccaaataaaacgattaaaa
ggaaatgtattgattattcattccggaggaaccttgagtatgcccgcatttgattatatt
taa

DBGET integrated database retrieval system