KEGG   Legionella longbeachae: LLO_1517Help
Entry
LLO_1517          CDS       T01183                                 

Gene name
odp
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
llo  Legionella longbeachae
Pathway
llo00010  Glycolysis / Gluconeogenesis
llo00020  Citrate cycle (TCA cycle)
llo00620  Pyruvate metabolism
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
llo01200  Carbon metabolism
Module
llo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_1517 (odp)
   00020 Citrate cycle (TCA cycle)
    LLO_1517 (odp)
   00620 Pyruvate metabolism
    LLO_1517 (odp)
Enzymes [BR:llo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LLO_1517 (odp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CBJ11884
Pasteur: llo1517
UniProt: D3HSJ6
Position
complement(1790391..1791503)
Genome map
AA seq 370 aa AA seqDB search
MNIFNLPDLGEGLPDAEIHEWFVKEGDTVVVDQPLVSMETAKAVVDVPCPQTGVISKLYG
KPGDIIKTGEPLVAFVSTASKAADKGTVVGNLEESSEVFEDNFTIGVQHATQGRIKTTPA
VKMLAKKLGVDLSTIKGTGEFGVITRDDVQTQADKNAQIPVGFEPLRGVRRAMLNSMVQS
HAEVVPVSIFDEADISAWKSGTDITVRLIRAIIEATKSEPALNAWFDTKHGARQCFNEVH
LGLAMDNEEGLFVPVIHDAGTRSDTELRSMINEFKQSVGNREITADKLKGATITLSNFGK
FAGRFASPIIVPPMVAILAVGRLYQGVVAVEGKVEIHNILPLSLSFDHRAVTGGEATRFL
GSIIQSLQMD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttcaatctacctgatttaggtgaaggcttacctgatgctgagattcatgag
tggtttgtcaaagaaggagatactgttgtcgtggatcagcctctggtttctatggaaaca
gccaaggcagtagtcgatgttccttgtccacagacaggagtaataagtaaattatatggc
aagccaggcgacattattaaaacaggagagcctttagttgcctttgtgtcgaccgcgtca
aaagctgccgataagggaaccgtcgttggcaacttagaagaaagtagtgaagtttttgaa
gataattttactattggagtacaacacgctactcaaggtcgtataaagacaacccctgct
gtaaaaatgcttgcaaaaaaacttggcgttgatttatctacgataaaaggtacaggcgaa
tttggtgtcatcaccagggatgatgtgcaaacccaagcagataaaaacgcccaaataccg
gtaggttttgaacctcttcgtggagtaagacgtgctatgctcaatagcatggttcagtca
cacgccgaagtagttcctgttagcatctttgatgaagcagatattagcgcctggaaatct
ggcactgatattaccgttcgtttaattagagctataattgaagccactaaaagtgaacct
gcattaaatgcatggtttgatacaaaacatggtgcacgacaatgttttaatgaagtacac
cttggcctggcgatggataatgaggaagggttgtttgttcctgttattcatgatgcagga
acacgatctgatactgaattacgcagtatgattaatgaatttaaacaatcagtaggtaat
cgtgaaattacagcagacaaattgaaaggagcgacgattacgctttccaattttggaaaa
tttgctggtcgtttcgcaagccccattatagtcccaccaatggttgcaatcttggctgtt
ggcaggctttatcaaggggttgttgcggtcgaaggtaaggtagaaatacataatatcctt
cctttatcacttagttttgatcacagggcagttacgggtggtgaagcaactcgtttctta
ggttcgatcatacaatccttacaaatggattag

DBGET integrated database retrieval system