KEGG   Legionella longbeachae: LLO_1517Help
Entry
LLO_1517          CDS       T01183                                 

Gene name
odp
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLO_1517 (odp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_1517 (odp)
   00020 Citrate cycle (TCA cycle)
    LLO_1517 (odp)
   00620 Pyruvate metabolism
    LLO_1517 (odp)
Enzymes [BR:llo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LLO_1517 (odp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1790391..1791503)
Genome map
AA seq 370 aa AA seqDB search
MNIFNLPDLGEGLPDAEIHEWFVKEGDTVVVDQPLVSMETAKAVVDVPCPQTGVISKLYG
KPGDIIKTGEPLVAFVSTASKAADKGTVVGNLEESSEVFEDNFTIGVQHATQGRIKTTPA
VKMLAKKLGVDLSTIKGTGEFGVITRDDVQTQADKNAQIPVGFEPLRGVRRAMLNSMVQS
HAEVVPVSIFDEADISAWKSGTDITVRLIRAIIEATKSEPALNAWFDTKHGARQCFNEVH
LGLAMDNEEGLFVPVIHDAGTRSDTELRSMINEFKQSVGNREITADKLKGATITLSNFGK
FAGRFASPIIVPPMVAILAVGRLYQGVVAVEGKVEIHNILPLSLSFDHRAVTGGEATRFL
GSIIQSLQMD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttcaatctacctgatttaggtgaaggcttacctgatgctgagattcatgag
tggtttgtcaaagaaggagatactgttgtcgtggatcagcctctggtttctatggaaaca
gccaaggcagtagtcgatgttccttgtccacagacaggagtaataagtaaattatatggc
aagccaggcgacattattaaaacaggagagcctttagttgcctttgtgtcgaccgcgtca
aaagctgccgataagggaaccgtcgttggcaacttagaagaaagtagtgaagtttttgaa
gataattttactattggagtacaacacgctactcaaggtcgtataaagacaacccctgct
gtaaaaatgcttgcaaaaaaacttggcgttgatttatctacgataaaaggtacaggcgaa
tttggtgtcatcaccagggatgatgtgcaaacccaagcagataaaaacgcccaaataccg
gtaggttttgaacctcttcgtggagtaagacgtgctatgctcaatagcatggttcagtca
cacgccgaagtagttcctgttagcatctttgatgaagcagatattagcgcctggaaatct
ggcactgatattaccgttcgtttaattagagctataattgaagccactaaaagtgaacct
gcattaaatgcatggtttgatacaaaacatggtgcacgacaatgttttaatgaagtacac
cttggcctggcgatggataatgaggaagggttgtttgttcctgttattcatgatgcagga
acacgatctgatactgaattacgcagtatgattaatgaatttaaacaatcagtaggtaat
cgtgaaattacagcagacaaattgaaaggagcgacgattacgctttccaattttggaaaa
tttgctggtcgtttcgcaagccccattatagtcccaccaatggttgcaatcttggctgtt
ggcaggctttatcaaggggttgttgcggtcgaaggtaaggtagaaatacataatatcctt
cctttatcacttagttttgatcacagggcagttacgggtggtgaagcaactcgtttctta
ggttcgatcatacaatccttacaaatggattag

DBGET integrated database retrieval system