KEGG   Legionella longbeachae: LLO_1570Help
Entry
LLO_1570          CDS       T01183                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
llo  Legionella longbeachae
Pathway
llo00010  Glycolysis / Gluconeogenesis
llo00071  Fatty acid degradation
llo00350  Tyrosine metabolism
llo00625  Chloroalkane and chloroalkene degradation
llo00626  Naphthalene degradation
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
llo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_1570
  Lipid metabolism
   00071 Fatty acid degradation
    LLO_1570
  Amino acid metabolism
   00350 Tyrosine metabolism
    LLO_1570
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LLO_1570
   00626 Naphthalene degradation
    LLO_1570
Enzymes [BR:llo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LLO_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CBJ11938
Pasteur: llo1570
UniProt: D3HSP9
Position
complement(1847739..1848722)
Genome map
AA seq 327 aa AA seqDB search
MYAMVMEQKGQQLVLKNIKKPEPKPNELLIKIHACGICRTDLHVLDGELTDPKLPLIPGH
QIVGTIEQLGSSASSFSIGQRVGVPWLGSSCETCSFCVSGRENLCDHARFTGYQIDGGFA
QYCVANHRFCFPIPEGYSDNQAAPLFCAGLIGYRALLKTADAKHLGLYGFGAAAHILIQV
ANKQGRKVYAFTTPGDDKAQNFAYQLGATWVGDSKQNPPHVLDAAIIFAPVGELVPHALR
NTLKGGTVVCAGIHMSDIPSFPYQILWGERTLCSVANLTRNDGKDFLQLAPQVPVKTEIH
TYPLTKVNEALDDLRHGRFTGAAVITL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtatgccatggttatggaacagaaagggcaacaactcgttcttaaaaacataaaaaaa
ccggaacccaaacctaatgagctattaattaaaattcacgcctgtggcatttgtcgcact
gatttgcatgtccttgatggggaattaacagatccaaagcttcctctaattccaggtcat
caaattgtaggtacaattgagcaattaggctcatcagctagctcttttagtattggtcaa
cgagtaggtgttccttggttgggaagcagttgcgaaacttgctcattttgtgtgtctgga
cgagaaaatctttgtgatcatgctcgatttactgggtatcaaattgatggtggatttgcc
caatattgtgtggctaaccatcgcttttgttttccaatacccgaaggatattcagataat
caagctgccccgcttttttgtgcgggattaattggatatcgtgcgttattaaaaacagct
gatgcgaagcatttaggtctgtatggttttggcgcggcagcacatattctaattcaagta
gccaacaagcaaggtcgcaaagtctatgcttttacaactccaggagatgataaagctcag
aatttcgcctatcaattaggggctacctgggttggggattcaaaacaaaatccaccacac
gtactcgatgcggcaattatttttgctcccgtgggggaactcgttcctcatgcactacgc
aatacgctaaaaggcggtactgttgtttgtgctggtatacatatgagtgatatcccgagt
ttcccttaccaaatcctttggggagagcgcactctgtgttctgtagcaaatcttacgcga
aatgatggtaaagactttttacaattagcaccacaagtacctgttaaaacagaaattcat
acctatccattaactaaagtgaatgaagcacttgatgatcttcgacatggacgttttaca
ggagcagcagtaattactctttga

DBGET integrated database retrieval system