KEGG   Legionella longbeachae: LLO_1933Help
Entry
LLO_1933          CDS       T01183                                 

Gene name
lig
Definition
DNA ligase (EC:6.5.1.2)
Orthology
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
llo  Legionella longbeachae
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:llo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LLO_1933 (lig)
   03410 Base excision repair
    LLO_1933 (lig)
   03420 Nucleotide excision repair
    LLO_1933 (lig)
   03430 Mismatch repair
    LLO_1933 (lig)
Enzymes [BR:llo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     LLO_1933 (lig)
DNA replication proteins [BR:llo03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    Other elongation factors
     LLO_1933 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2274837..2276852)
Genome map
AA seq 671 aa AA seqDB search
MIIDEIKEQAARLKDKIRQYDYHYYVLDEPLVPDVEYDRCFRALQNLEAQHPELLTADSP
TQRVGGTPADAFAPVTHRQPMLSLSNVFSEEELQAFVKRVTEKLDEPAQQLVFTCEPKLD
GLAVNITYENGVLVYAATRGDGTTGENITANIKTIAAIPLVLRSNKPPRFIEIRGEVYMP
KSGFEQYNKKAKELGEKTFANPRNAAAGSLRQLNPAVTANRPLAIYCYGIGACEDYRLPN
THWEQLQLLKELGFKVSSESKREVGIKGCLDYYCNMLARRDQLPFEIDGVVYKVDSIALQ
QQLGFISRAPRFACAHKFPATEEITEILAVDFQVGRTGALTPVARLAPVNVAGVTVSNAT
LHNMDEITRKDIRIGDKVIIRRAGDVIPEVVSVVLEQRPADTKEICLPLKCPVCDSDVVR
EEGEAVARCIGGLFCKAQLKRMMWHFASRKAMHIEGLGSVLIEQLVDEGIVRHLPDLYRL
DVSTLANLPRMGEKSAKNLLQALEHSKKTTLSRFLYALGIREIGEASARVLAEHFGDIEA
ISNATEADLMSLEDMGPVGAANIVHFFAQTHNLQVIQHLLELGIHWPKIEKKQQNKEHPL
FGKTVVLTGTLNTLSREEAKAKLLILGAKVSGSVSAKTDYVIAGIEAGTKLDKANNLGIS
ILDEEQFLHML
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgaaataaaggaacaagcggctagactaaaagataagataagacagtat
gattatcattactatgtactggatgaacctttagtacctgatgttgagtatgatcgatgt
tttcgtgctttacaaaatttagaagcgcagcatcctgaattattgactgctgattcacca
acacaacgtgtcggaggtactcccgcagatgcttttgctcccgtaacccacagacaacct
atgttgtccttgtcaaatgttttcagtgaagaagagttacaggcatttgttaagcgagtc
actgaaaaattagatgagccagctcagcaattagtttttacgtgtgagccaaagttggat
ggtcttgctgtaaatattacttatgaaaatggagtattggtttatgcagccactcgtgga
gatgggactacaggtgaaaacattactgccaacattaaaacgattgcagcaataccttta
gttttaagaagcaataagccgcctcgttttattgaaatacgtggcgaagtatatatgcca
aaatcagggtttgagcaatacaataaaaaagccaaagaattgggtgaaaaaacctttgcg
aatccacgtaacgcagctgctggaagtttacggcaattgaatcctgcagtaacggcaaat
agaccattggcgatttattgttatggtattggcgcttgtgaagattatcgtttaccaaac
actcattgggagcaattgcaattactaaaagaacttggttttaaagtttcttctgaatca
aaaagggaagtgggaattaaaggttgtttggattattactgcaacatgctcgccaggcgt
gaccaacttccttttgaaatcgatggtgttgtgtataaagtggatagtattgctttacaa
cagcaattgggttttatttcccgagcccctcgttttgcttgcgcacataaatttccagct
accgaagaaataacagagattttagccgttgattttcaagttgggagaaccggggcttta
acgcccgtggctcgtttagcgccagtaaatgttgctggggttacggtgagtaatgccacg
ctgcataatatggatgaaattaccagaaaagatattagaataggggataaagtgattatc
cgtcgcgctggcgatgtcattcctgaggtggtttcagttgttttagaacaacgacccgca
gatactaaggaaatttgtttacctctgaaatgccctgtttgtgattctgatgtcgttcgt
gaagaaggtgaagcggttgcccggtgtattggtggtttgttttgcaaagcccaattaaaa
agaatgatgtggcattttgcctcacgtaaggcaatgcatattgaaggattaggttcggtt
ttaatagaacaattggttgatgaaggtattgtacggcatctccctgatctttatcggctt
gacgtttctacattggcaaatcttccgcgtatgggtgagaagtctgcaaaaaacttatta
caagccttagaacatagcaaaaagaccacattaagtcgttttctttatgctttaggaatt
cgcgaaattggtgaggcaagtgctcgggtgttagcagagcattttggagatattgaagca
atttcaaatgcaacagaagcagatctcatgagtttggaggatatggggcctgttggcgct
gcaaatatagtccatttttttgcacaaactcacaacctgcaagtgattcaacatttgtta
gaacttggaattcattggccaaaaattgagaaaaaacagcaaaataaggagcacccttta
tttggaaaaactgtggtactcactggaactttaaatacactgagtcgagaagaggctaaa
gcgaaattactcatcttgggtgccaaagtaagtggtagcgtatcggcaaaaacagattat
gtgattgctggcattgaagcagggacaaagcttgataaagcaaataatttagggatttct
atcttggatgaagaacaatttcttcatatgttataa

DBGET integrated database retrieval system