KEGG   Legionella longbeachae: LLO_2030Help
Entry
LLO_2030          CDS       T01183                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthases
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
llo  Legionella longbeachae
Pathway
llo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01130  Biosynthesis of antibiotics
llo01230  Biosynthesis of amino acids
Module
llo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLO_2030 (trpC)
Enzymes [BR:llo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LLO_2030 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CBJ12416
Pasteur: llo2030
UniProt: D3HJ35
Position
2378658..2379437
Genome map
AA seq 259 aa AA seqDB search
MNSVLQRITHKKLEEISLAKKKRPLDSLKQQPLMEQRNFCGALQAQESPAIIAEIKRASP
SKGIIREDFNVVEITKIYALHGARCLSVLTDIDFFQGHPDYLAQAKMHCNLPVLRKDFIL
DTYQIYESLALGADCILLIVALLDDAQLIEFCQLAQELGMAVLVESHTQEELERALRLPT
PLIGVNNRSLHTFHTNIQLSIDLKHYIPKDRITITESGINTHADIRLMQSHGINTFLVGE
SLMRAKDIGKALDQLIEGI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgtactacagcgtattactcacaaaaaattagaagaaattagtttggccaag
aaaaaaaggcctttagattcattaaaacaacaaccattaatggagcaaagaaatttttgt
ggtgctttacaagctcaagaatcaccagctattatcgcagaaattaaacgagcgtccccc
agtaaagggatcattcgagaagattttaatgtagtagaaatcacaaaaatatatgcgcta
catggagcacggtgtctttcagtacttactgatatcgactttttccaaggtcatccagat
tatttagctcaagcgaaaatgcattgtaacttgccagtattgcgtaaagattttattctt
gatacctatcaaatatatgaaagcttagctttgggtgctgactgtattttacttattgtc
gctttacttgatgatgctcagttaattgagttttgccaattggctcaggagcttggtatg
gccgtccttgtagaaagccatactcaagaagaactcgaacgtgctttacgtttacctact
ccattaataggagtcaataaccgaagtcttcatacgtttcataccaatatacagttgagt
attgatttaaaacactacattcccaaagatagaataaccattactgaaagcgggattaat
acccatgcagatattcgtttgatgcagtctcatggcataaacacatttcttgttggagaa
agcttaatgagggctaaagacataggtaaagcattagatcaacttatcgagggaatataa

DBGET integrated database retrieval system