KEGG   Legionella longbeachae: LLO_2801Help
Entry
LLO_2801          CDS       T01183                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
llo  Legionella longbeachae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:llo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3277307..3278602
Genome map
AA seq 431 aa AA seqDB search
MLKRICFLMLFLFVSQAISSVFSLEEVQKLKQHFFSNIQPNGAIVASPSKQNPNYYYDWI
RDSAIAMNLIETWYESTHAYGYKERLFHYVDWTQILQHQDNPNHGYDILGEPKFYVNGYP
FNEQWGRPQNDGPALRASVLIHFAQQLLDNHETEYVKTRLYSNTMDPHTMGVIKMDLEYI
SHHWPDPNYDLWEEVYGDHFFTAMLQQKALLEGATLARRLNDNGAAVYYEQQAQQIDSRL
RQHLDKNHQIIQATLLPHPGPQKTLELDSAVILGVLFNPQKNGDFSPNSFYVQNTVQALH
EQFNLMFPINQNNPGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYYTLASNLSMI
EENQSQIAEYIKAGDNYLKLIKKYAPDMQLSEQINLNTGAQQGASSLTWSYVAVLHAIDY
RDKLINKLNSN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaggatctgttttttaatgttatttttatttgtttcccaagcaataagttct
gtatttagcctcgaagaggtacaaaagttaaagcagcactttttttctaacattcagcct
aacggcgcaatagtagcttcaccctcaaaacaaaatcctaattattattacgattggata
agagattccgcaattgctatgaatttaattgaaacatggtacgagtcaactcatgcttat
ggatataaagagcgtttgtttcattatgtagattggacgcaaatacttcaacaccaagat
aatccaaatcatggatacgatatattaggggaacctaaattttatgttaatggttaccct
tttaatgaacaatggggaaggcctcaaaatgatggccccgctttaagagcctctgtattg
attcattttgcacaacagttactagacaatcatgaaacagaatatgttaaaacccgttta
tatagtaacactatggatccccataccatgggtgtgattaaaatggatttggaatatata
tcacatcattggccagaccccaactatgatctttgggaagaagtctatggagatcatttt
tttactgcaatgctacaacaaaaagcacttcttgaaggagcaactcttgcacgccgcctt
aatgataatggtgctgcggtctattatgaacaacaagcacaacaaatagattcccgtctt
cgccaacacctggataagaatcatcaaatcattcaagcaactcttttacctcatccaggc
cctcaaaaaacattggaactggactctgcagtgattcttggcgtcttatttaatccacaa
aaaaatggggacttctcgcctaacagcttctatgttcaaaatacagttcaagccttacat
gaacagttcaatttaatgtttccgattaaccagaataatcctggtgctattttatttggc
cgttatccaggggatacttatgacggttatcaaacgaacagtataggcaatccctggttt
attttaacggcaacaatggccgaatattattatacactggccagtaacttatcgatgatc
gaggaaaatcaatcccaaatagcagaatacattaaagccggtgataattatttgaaactc
ataaaaaaatatgcgccagatatgcaattgagcgaacaaattaacttaaatactggagca
caacaaggagcatcatcgcttacctggagttatgtggccgttttacatgcgattgattat
agagataaattaataaataaattaaattccaattaa

DBGET integrated database retrieval system