KEGG   Legionella longbeachae: LLO_2982Help
Entry
LLO_2982          CDS       T01183                                 

Definition
(GenBank) putative phosphoglycerate mutase family protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBJ13429
Pasteur: llo2982
UniProt: D3HLU9
Position
complement(3462265..3463029)
Genome map
AA seq 254 aa AA seqDB search
MQEKKECIDKKEEQKSSSLSSGLFHSVFSSVSPDSSFRRGNAKIVIMRHAETLWNEPRKR
IQGQSPNAEIELSEKGKQDIIRTLDSSKTPDLLILSPLHRCIQTAETWFGMQFKQIKTPT
VFIEGLKEVNAGKLEGLYVDELSGEPEKIWNLWKNDPLGFPGFPDGETLEEFQHRVLQTF
SELCNSYGDKPQEICIITHGGPMRVLGCFLNDKDLSHLWDHTVTNLERLELTRDQIIRLQ
NYVQENTLNSFPIL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaaaggaatgtattgataaaaaagaagagcaaaaaagttcttctctgagt
tcaggcctatttcatagcgttttttcctctgttagcccagattcttcttttaggagaggg
aatgcgaaaattgttattatgcgccatgccgaaacgctctggaatgagcctagaaagcga
atacagggacaatctcctaacgctgaaattgaactatcggagaaaggcaagcaagatatt
attaggacattggattctagtaaaacccctgatttattaattttaagccctctgcatcga
tgtatacaaacagcggaaacatggtttggtatgcagtttaaacaaataaaaacccctaca
gtttttattgagggtttaaaggaagttaatgccggtaaattagagggactttatgtagac
gagctttctggggaaccagaaaaaatatggaatctctggaaaaatgatcctcttggattt
ccaggttttcctgacggtgaaacattagaagaattccaacatagggttttacaaacattc
tcggaactttgcaatagttatggtgataaacctcaagagatctgtattatcactcatggt
ggccctatgcgcgtattgggatgctttcttaatgataaagatttatcccatttatgggat
catacggttactaatcttgaaaggttagaactaacccgcgatcaaatcattcgcttgcaa
aactacgtacaggaaaatacgttgaattcttttcctattctataa

DBGET integrated database retrieval system