KEGG   Legionella longbeachae: LLO_2982Help
Entry
LLO_2982          CDS       T01183                                 

Definition
(GenBank) putative phosphoglycerate mutase family protein
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_2982
  Energy metabolism
   00680 Methane metabolism
    LLO_2982
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLO_2982
Enzymes [BR:llo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LLO_2982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3462265..3463029)
Genome map
AA seq 254 aa AA seqDB search
MQEKKECIDKKEEQKSSSLSSGLFHSVFSSVSPDSSFRRGNAKIVIMRHAETLWNEPRKR
IQGQSPNAEIELSEKGKQDIIRTLDSSKTPDLLILSPLHRCIQTAETWFGMQFKQIKTPT
VFIEGLKEVNAGKLEGLYVDELSGEPEKIWNLWKNDPLGFPGFPDGETLEEFQHRVLQTF
SELCNSYGDKPQEICIITHGGPMRVLGCFLNDKDLSHLWDHTVTNLERLELTRDQIIRLQ
NYVQENTLNSFPIL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaaaggaatgtattgataaaaaagaagagcaaaaaagttcttctctgagt
tcaggcctatttcatagcgttttttcctctgttagcccagattcttcttttaggagaggg
aatgcgaaaattgttattatgcgccatgccgaaacgctctggaatgagcctagaaagcga
atacagggacaatctcctaacgctgaaattgaactatcggagaaaggcaagcaagatatt
attaggacattggattctagtaaaacccctgatttattaattttaagccctctgcatcga
tgtatacaaacagcggaaacatggtttggtatgcagtttaaacaaataaaaacccctaca
gtttttattgagggtttaaaggaagttaatgccggtaaattagagggactttatgtagac
gagctttctggggaaccagaaaaaatatggaatctctggaaaaatgatcctcttggattt
ccaggttttcctgacggtgaaacattagaagaattccaacatagggttttacaaacattc
tcggaactttgcaatagttatggtgataaacctcaagagatctgtattatcactcatggt
ggccctatgcgcgtattgggatgctttcttaatgataaagatttatcccatttatgggat
catacggttactaatcttgaaaggttagaactaacccgcgatcaaatcattcgcttgcaa
aactacgtacaggaaaatacgttgaattcttttcctattctataa

DBGET integrated database retrieval system