KEGG   Legionella longbeachae: LLO_3002Help
Entry
LLO_3002          CDS       T01183                                 

Definition
(GenBank) putative transmembrane protein (fibronectin III domain and Gp5 C-terminal repeat)
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3487689..3497678)
Genome map
AA seq 3329 aa AA seqDB search
MQRLRIAQLFITLSVFLVMAMAHAGNPVWTFAPVAGFPPTVTVDKMGSATVKYTVTNQSS
RKHTLVMLPQRGISQVQPCQLAPKGTCTLTLIVNGSLVPPSGISGGPALCQAKSNGSPNP
NQCYRPSQGNELNIKTATIPGAPTQVTAVAGVASASVSWVAPSDNGGSPIISYTVVSNPQ
GYTCKTSGLTCTVQGLTNGTTYTFRVSATNVIGTGPLSSPSNPVTPGIYTITPSAGANGT
ISPNSPQTVIYGDNITFLATPSTGYTVSGWTVDGAPYTACHRSTTCQLTNVSADHTIAVN
FTKKILIVRPRGGAHGSISPNTLQPVAYGGDITFTGIPDTGYIVKGWRVDGVPYPACGAS
PTCQLKNVTTSHLIAVSFVKQRFTITPSAGTNGTISPDTKQIVAYGGNSPIFTATPSTGY
VVSGWTLDGAPYAACSTKTTCQITNVTANHAIAVSFAQETFSITPSSGANGTISPNTIQT
VVYGDDIAFTATPDAGYIVAGWSLDGAAYAACGTDTTCQLANVQANHTIAVSFTQQTFSI
SPSAGANGTISPDTEQIVTYGANSPIFTAAPSTGYVVSGWTLDGAPYTACGTDTMCQLTN
VTADHAIAVSFAQETFSITPSSGANGNISPNTTQTVAYGNNITFTASPNTGYAVGGWTVD
GTSYAACGTNTTCQLTDVQANHTIAVSFVQQTFSITPSSGANGSINPDTIQTVAYGNDIS
FTAAPSTGYEVSSWTVDGSPYDTCGTNTTCELSNVTADHTIAVSFTQKTFFILPRGGANG
AISPSTLQTVVYGADSTTFTAIPNTGYVVSGWRVDGVPYDVCGTNTTCQLTNVTANHIIT
VRFTQETFTITPSAGTNGTISPSDPTSVNYGDNISFTATPSTGYVVSGWTLDGAPYAACG
TGTSCQLTNVTADHTIAVSFTQQTFSIAPSSGANGSISPDTVQTVTYDSDSPIFTATPDT
GYDVEGWTVDGVSYGACGTNTTCQLTNVQANHTIAVSFVQQTFSISPNAGANGSIDPNTI
QTVAYGNDISFTAIPNTGYKVSGWLVDNVAYAECGTNTTCQLADVTADHTIEVSFTQETF
FILPRGGANGTISPSTLQTVVYGADSTTFTAAPNTGYVVSGWRVDGVPYDVCGTNTTCQL
TNVTANHIITVRFTQETFTITPSAGANGTISPSDPTTVVYGSNITFTATPNTGYAVSGWT
LDGVPYAACGTNASCQLSNVQSDQSIAVSFIQTFTVSPSAGANGTISPGTDQTVIAGDDI
TFTATPDASYNVAGWTVDGVAYAPCATNTTCQLTNVTADHEIAVSFNQTFIITPSAGANG
TISPNTPQAVTAGADSPTFTASPDAGFTVTGWTVDGTAYPACGTDTSCQLNNVQANHTIA
VSFVETFTITPSAGANGSISPNTVQTVNSGDSITFTATPDTGSIISGWTVDGSAYPTCGT
STTCELSNISANHTIAVSFIQTFTITPSAGENGSISPDTVQTVNSGDNISFTATPNTGYE
VSGWLVDNVAYPTCGANTTCQLTDISSNHTITVNFAQQALTVTSSAGANGSITPAGATQV
PYGENVSFTATPSTGYVVSNWMVDGVSYDSCGADQVCDLTNVTTAHTIVVNFVQQTFNVT
PSAGTNGAIDPDSVQTIAYGGSVTFTASPNVGYEVSEWQVNGARYDGCGTSTACELTNIT
SNQTITVNFASQTFTVTSNAGANGSITPNGTTTVVYGENASFTATPSTGYEVSEWLVNGA
TYSACGTSTTCELTNITSNQTITVNFASQTFTVSSNAGANGSITPDGITQVVYGESASFT
ATPNTGYEVSEWQVNGARYDGCGTSTTCELTNITSNQTITVNFALQTFTVTSSAGANGSI
TPDGTTQVAYGANLSFTATPSTGYVVSNWMVDGVSYDSCGADQVCELTNVTTAHTIVVNF
VQQTFSVTPSAGTNGAIDPDSVQTIAYGGSVTFTASPNVGYEVSEWQVNGARYDGCGSST
ACELTNITSNQTITVNFASQTFTVTSNAGANGSITPNGTTTVVYGENASFTATPSTGYEV
SEWLVNGATYSACGTSTTCELTNITSNQTITVNFASQTFTVSSNAGANGSITPDGITQVV
YGESASFTATPNTGYEVSEWQVNGARYDGCGTSTTCELTNITSNQTITVNFALQTFTVTS
NAGANGSISPDGTTPVVYGENASFTATPNTGYEVSEWQVNGARYDVCGTYTTCELTNITS
NQTITVNFALQTFTVTPQAGENGSIMPSSPVQVSYDGNYTFTASPNQGYEVSEWQVNGAR
YDACGTSTTCQLTNITSDQTITVNFVSQTFTVTSNAGANGTITPDGTTQVLYGEDATFTA
AATTTGYVVSEWLVNGVRYDACGTDTVCVLTNVTSNQTITVNFVLEQFTIIPISGGNGAI
YPNTPEQVAYGANSSVYSANPDTGYTVSGWVLDSSTAVCGTNSTCQLTNVTANHTLTVNF
IQTFTVTSSAGANGSIDPAGETQVSSGGNITFTATPSSGYVVNKWQVNGSDYAACGKDTT
CQLTNVTSNQTIFVSFIQSTTISVKGSPLLLTPNTTGYLTVTNNGSVTAIDVQATLPPDL
AADVTQNASNCVSLASKSSCYLQFTSNAQVHSATTITIAGTNTNSVNATLSVAVPYVAND
IVYATVLDKVNNIIYIGGDFTQVGPNTGFGVPVDIHKGLFETVYPSVNGPVLSVVSDGFG
GWYIGGNFSQVGGVERDNLAHILHDGSLDLSWEPKVNGAVHVLKLSNNTLFAGGRFTSIN
GQERFHIAALDAYTGYPTSWSPNVDGTVYALAVTEGSVYLGGDFTSINGQPRKNIATVDV
DTAKLRSWSPNADRKVTSLLLGDHGVYVGGDFTVIGKQNRNHLAEIDAYSGLATSWNPNA
NKPVKSLIFGANMIYAGGEFTSIGGQNRNHIAAIDIRSGLANSWNPNADESVNSLLLGDN
MIYAGGDFTAIGGQNRNHIAALDINTGTANSWKLNADRSVDTLAMSGSTVYLGGKFSSLA
AVTRNHAAAISADSGEVTSWNPNLNGTVKTLFLSGNQVYIGGEFNVVGTSPNQSVIYYIT
RVSTSDAVADPFWHPNPDGAVNSVVVGANAVYIGGLFSKITLNNATRNGIAALDIGGNGG
AQQNWNANLSGAQIYSIVVSDQVYFGGFYFTPSLQQKFIGAASLTTGALNSTWSVNANDI
VRSLALNGSTMYLGGDFTTISGADANNNTIQYDRNYIAAVSTSGKGIVTAWNPDADDAVY
ALALSDNTLYAAGAFSNIGSKSRSGIAALNADTNSTGSATSWTANLLLPGIGYAIALSDS
TVYIGGDFNSVGGSQSSNFAIVPMRLPSP
NT seq 9990 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagattacgaattgctcagttattcatcacattgtccgtttttttagtcatggcc
atggctcatgcaggaaaccctgtatggacatttgcacctgttgcaggcttcccaccgact
gtgacagtggataaaatgggtagtgccacggttaaatatacagtaacaaaccaatcaagt
agaaagcacaccctggtgatgttgcctcaacgaggaataagccaggttcaaccgtgtcaa
ttggcacctaagggtacctgtacgctcactttgatcgtcaatggaagtcttgtccctcct
tctggtatttcaggtggccccgctctttgccaggccaaatctaatggatcccccaatcct
aatcaatgctatcgtccaagccaaggcaatgaactgaatattaagacagcaactatacca
ggagcacctactcaagtaactgcggtggcaggggttgcttctgcatcggtgagctgggta
gcgccaagtgataatgggggttctcccataatttcatatacggtggtttccaatccccag
ggctatacatgcaaaacatcaggattaacgtgtacggttcagggattaaccaatggaaca
acttacactttcagagtctctgctactaatgtgataggaacaggccctttatcaagtcca
tcaaatccagtgacacccggtatttatacaattaccccaagcgcgggagcaaatgggact
atttcacccaatagcccacaaacagtaatttatggtgataatattacatttcttgctact
ccgagcacaggttatacagtcagtggctggactgtagacggcgctccttatacagcctgc
catagaagtacaacatgccaattaaccaatgtgtctgctgatcatacgattgcagtcaat
tttaccaagaagatcttaattgttaggccaaggggtggggcgcatggcagtatttcgcca
aacacattacaacctgtagcttatggaggcgacattaccttcaccggaatacccgatacg
ggttatatagtgaagggttggagagtagatggtgttccctatcctgcatgtggtgcaagt
ccaacatgtcaattaaagaatgtgaccaccagccatctgatagctgtcagttttgtgaaa
caaagattcacgattacgccgagcgcaggaacaaacggaactatttcacctgatacaaag
caaattgtagcctatggtgggaatagtccaatatttacagcgactccaagtaccggttac
gttgttagtggctggacattagatggtgccccgtacgcggcatgtagtaccaagacgacg
tgccaaataacgaatgtgactgctaatcatgcgattgcagtcagttttgctcaggaaaca
ttcagcattacgccgagctcaggggcaaacggaactatttcacccaataccatccagact
gtagtttatggtgatgacatcgccttcacggctactccagatgcggggtatatcgttgca
ggttggagcctggatggtgctgcttatgcggcgtgtggtacggatactacgtgccaatta
gccaacgtccaagctaaccatacaattgccgttagtttcactcagcaaacctttagcatc
agcccaagtgcaggggcaaatgggactatttcaccagatacagaacaaattgtaacctat
ggtgcgaatagtccaatatttacagcggctccaagtactggttatgttgttagtggttgg
acattagatggcgccccgtatacagcatgtggtacagatacaatgtgccaattaacgaat
gtgaccgctgatcatgcgattgcggtcagttttgcgcaggaaacattcagcattacacca
agctcaggggcaaacggaaacatttcacccaatacaactcagaccgtagcttatggaaat
aacattacgttcaccgcgagcccaaatactggttatgctgtgggtggttggactgtggat
ggaacctcttatgcagcatgtggtacgaatacaacgtgccaattaaccgatgtgcaagcc
aaccacacaattgcagtcagttttgttcagcaaacctttagcattacccccagttcggga
gcaaacggaagcattaaccccgacaccatccaaacggtagcttatggtaacgacattagc
tttactgcagcaccgagtactggttatgaggtgagtagctggacggtagatggtagtcct
tatgacacctgtggtacaaatactacgtgtgaactatctaatgtgactgcagatcatacg
attgcggtcagttttactcaaaagacgttttttattctaccaagaggcggggcaaatgga
gctatttcccccagcaccttacaaacggtggtttatggtgcagacagtacgacattcact
gcaattccgaatacgggttacgtggtgagtggttggagggtagatggtgttccctatgat
gtgtgtggcaccaatacaacgtgtcaattaaccaatgtaactgccaatcatataattaca
gtacgctttactcaggagacattcacaattacgccgagtgcgggaacaaatgggactatt
tcaccctccgacccaacatcggtaaattatggagataatataagcttcactgcgactccg
agtacaggttatgttgttagtggatggacattagatggcgcaccctatgcagcatgtggc
acaggtacttcgtgtcaattaacgaatgtgaccgctgatcatacgatcgcggttagtttt
actcagcaaacgtttagcattgccccaagttcaggtgcaaacggaagtatttcacctgat
acagtccaaaccgtaacatatgattcagatagtccaatattcactgcgactccggatact
ggctatgatgtggagggatggactgtagatggtgtttcttacggagcatgtggtacgaat
acaacctgccaattaaccaatgtgcaagccaatcacacaattgcagtcagttttgttcag
caaacctttagcatcagccccaatgcaggagcaaatggaagcattgaccccaacaccatt
caaacggtagcttatggtaacgacatcagcttcactgcaataccgaataccggttataag
gttagtggctggttagtcgataatgttgcttatgctgagtgtggaacgaataccacctgc
caattggctgatgtaactgcagatcatacgattgaggtaagttttactcaagaaacgttt
tttattctgccaagaggtggggcaaatggaactatttctcccagcaccttacaaacggta
gtttatggtgcagacagcaccacattcactgcggcgccgaatacgggttatgtagttagt
ggttggagggtagatggtgttccctatgatgtgtgtggcaccaatacaacgtgtcaatta
accaatgtaactgccaatcatataattactgtacgctttactcaggagacattcacgatt
acgccgagtgcgggagcaaatgggactatttcaccctccgacccaacaactgtagtttat
ggaagtaacatcacattcactgcgactccaaacaccggttatgctgttagtggttggaca
ttagatggtgtaccctatgcagcatgtggtaccaatgcatcgtgccaattaagcaatgta
caatctgatcaatcaatagcagtcagttttattcaaacatttactgttagtccaagtgcc
ggtgcaaatggaactatatcacccggcacagaccaaaccgtaatcgcaggagatgacatt
acttttacagcaactccagatgcaagctacaatgtggctggatggactgttgatggagta
gcttatgctccatgtgctaccaatacaacgtgtcaattaaccaatgtgactgcagatcat
gagattgcggtcagttttaatcaaacgttcattattacgcccagtgcaggcgctaatggg
actatttcgccaaacacgccacaagccgtaactgctggtgcagatagccccacttttact
gcatctccagatgcaggctttacagtcactggttggaccgtggatggtactgcttatccg
gcatgtggaacggatacgagctgtcaattaaacaatgtacaagctaatcatacaattgca
gttagttttgttgaaaccttcacgattactccgagtgcgggagcaaacggaagcatttct
ccaaacacagtgcaaactgtaaactcaggggatagcatcactttcactgcaaccccggac
actggttctattattagcggttggaccgtagatggttctgcttatccaacatgtggtacg
agtacaacctgtgaattaagcaatatatctgccaatcatacgattgcagtcagttttatc
caaacgttcacgattacaccgagtgcgggagaaaatgggagtatttctccagacacagta
caaactgtaaactctggagataatatttcatttacagcgactccaaatactggctatgag
gtcagtggctggttagtagataacgtcgcttatccaacctgtggagcgaatacgacgtgt
caattaactgacattagttccaatcatacgattacggtaaattttgcccagcaggcgctt
acggttacctccagtgcaggagcaaatggaagcattacaccggccggtgcgacccaggta
ccttatggcgagaatgtaagcttcacggcaactccaagcacaggctatgtagtgagcaac
tggatggtagatggagtttcttatgactcgtgcggtgcagatcaagtatgtgatttaact
aacgtgaccactgctcatacgatagtggtcaattttgtgcagcagacattcaatgttacg
cccagtgcaggaacaaatggagctattgaccctgattcagttcaaacgatagcctatggt
ggaagtgtcacctttacagcgagtcctaacgtaggctacgaagtaagtgaatggcaggta
aatggagcccgttatgatgggtgtggaacgagcacggcctgtgaattaaccaacatcact
tctaatcagacgattacggtcaattttgcgtcgcagacgtttacagttacctcaaatgcg
ggcgccaatggaagcattacaccaaacggcaccaccacggtagtttatggtgagaatgca
agctttacggcaactccgagcactggttatgaggtcagtgaatggctggtaaatggagct
acttattcagcgtgtggaacgagcacgacctgtgaattaaccaacattacttctaatcag
acgattacggtcaattttgcatcgcagacgtttacggttagttcaaatgcaggcgccaat
ggaagcattacaccagacggcataacccaggtcgtttatggtgagagtgcaagctttacg
gcaactccaaatactggctacgaagtcagtgaatggcaggtaaatggagcccgttatgat
gggtgtggaacgagtacaacctgtgaattaaccaacattacttctaatcagacgattacg
gtcaattttgcgctgcagacgtttacggttacctcaagtgcgggagcaaatgggagcatt
acaccagacggaactacccaggttgcttatggtgcgaatctaagcttcacagcaactcca
agcacaggctatgtagtgagcaactggatggtagatggagtttcttatgactcgtgtggt
gcagatcaagtatgtgaattaactaacgtgaccactgctcatacgatagtggttaatttt
gtgcagcagacattcagtgttacgcccagtgcaggaacaaacggagctattgaccctgat
tcagttcaaacgatagcttatggtggaagtgtcacctttacagcgagtcctaacgtaggc
tacgaagtaagtgaatggcaggtaaatggagcccgttatgatgggtgtggatcgagcacg
gcctgtgaattaaccaacatcacttctaatcagacgattacggtcaattttgcgtcgcag
acgtttacagttacctcaaatgcgggcgccaatggaagcattacaccaaacggcaccacc
acggtagtttatggtgagaatgcaagctttacggcaactccgagcactggttatgaggtc
agtgaatggctggtaaatggagctacttattcagcgtgtggaacgagcacgacctgtgaa
ttaaccaacattacttctaatcagacgattacggtcaattttgcatcgcagacgtttacg
gttagttcaaatgcaggcgccaatggaagcattacaccagacggcataacccaggtcgtt
tatggtgagagtgcaagctttacggcaactccaaatactggctacgaagtcagtgaatgg
caggtaaatggagcccgttatgatgggtgtggaacgagtacaacctgtgaattaaccaac
attacttctaatcagacgattacggtcaattttgcgctgcagacgtttacggttacctca
aatgcgggcgccaatggaagcatttcaccagacggcacaaccccggttgtttatggtgag
aatgcaagctttacggcaactccaaatactggctatgaagtcagtgaatggcaggtaaat
ggagcccgttatgatgtgtgcggaacgtatacgacctgtgaattaaccaacattacttct
aatcagacaattacggttaattttgcactgcagacgtttacggttacaccccaggcagga
gaaaatggaagcattatgccatctagcccggtacaggtaagttatgatggtaactatacc
tttacagcgagccctaaccaaggctacgaagtgagtgaatggcaggtaaatggagcccgt
tatgatgcttgtggaacaagtacgacatgtcaattaaccaacatcacctcagatcaaacg
attacggtcaattttgtgtcacaaacctttacggttacctcaaatgcaggagcaaatgga
accattacaccagatggcacaacccaggtactatatggcgaggatgcaaccttcactgcg
gctgcgacgactactggctatgtcgtcagtgaatggctggtaaatggagtgcgttatgat
gcgtgcggtacagatacagtatgcgtattaaccaacgttacttctaatcagacgattacc
gtaaattttgtcttggaacagttcacgattatcccgatttccggcgggaatggagcaatt
tacccaaatacacccgagcaagttgcttatggagcaaatagttcggtatatagtgcaaat
ccagatactggttatacggttagtggttgggtattagatagctctactgcagtgtgcggc
acgaattcaacgtgccaattaactaatgtgaccgctaatcacacactcactgtcaatttt
atccaaacgtttaccgtcacctcgagtgcaggtgctaatggaagcattgacccagctggc
gagactcaggttagttctggtggaaatataacgttcactgcaaccccgtcctcgggttat
gtagtcaataagtggcaggtaaatggctctgattacgcagcgtgcggcaaagataccacc
tgtcagttaactaatgtgactagtaatcaaactattttcgtcagttttatccaaagtact
acaatttcagttaaagggtctccgctattactgaccccaaatacaacgggatatctgacg
gtaacaaataatggttcagtaacagcaatagatgttcaggcaacattacctcctgatcta
gccgctgatgtgactcaaaatgccagtaactgtgtttctcttgcttctaaaagtagttgt
tatttgcaatttacttcaaatgcgcaagtgcattcagcaacaaccattacgattgctgga
acaaataccaattcggttaatgcaactttgagtgtggcagttccttatgtagcgaatgat
attgtttatgcgacagtgctggataaagtgaataatattatctacataggtggcgacttt
acacaagttgggccgaatacgggttttggtgttccagtagacatccataagggcttattc
gaaacagtttatccctctgtcaatggacctgtgctttctgtggtatcggatggctttggt
ggctggtatattggcggtaattttagtcaggtaggtggagttgaacgtgataatcttgcc
catatactccatgatggtagtctggatttaagctgggagcccaaagtaaacggtgctgta
catgttcttaagctcagtaataatacactgtttgcgggtggacgctttacgagcattaat
gggcaagaacgttttcatattgcagcgctggatgcgtataccggctatcccacttcatgg
agccctaatgttgatggaactgtttatgcacttgcggttactgagggtagtgtttatctg
ggaggagattttacaagtattaatggacaaccgcgaaaaaatatagccactgtggatgtg
gatacagctaaactaagatcatggagtcccaatgcggacagaaaagtaacaagtcttcta
ttaggtgatcatggtgtttatgtcggtggagactttacagttattgggaaacaaaatcgt
aaccatcttgcagaaattgatgcatatagcgggttggcaacttcatggaatccgaacgcg
aataagccggtaaaaagcttaatatttggtgctaatatgatttatgctggcggcgagttt
acctctataggcggacaaaaccgtaaccatattgcagccattgatattagaagtggattg
gccaattcatggaatccaaatgcggatgagtctgtcaatagtctcttattaggcgataat
atgatttacgctggaggagactttaccgccattgggggacaaaatcgtaatcatattgca
gcacttgatattaacacgggtacagctaactcttggaaactgaatgctgatcgaagtgtg
gatactttggcgatgagtggcagtacggtttatttaggaggcaaatttagtagcctcgct
gcggtgactcgaaatcatgctgctgctattagtgctgatagcggtgaggtgacctcatgg
aatccaaaccttaatggtacagtaaagacccttttcctaagcggtaatcaagtttatata
ggtggggaattcaatgttgttggtacatcccctaatcaatcggtaatttattatattaca
cgtgtgagtaccagcgatgctgttgcagatcctttttggcatccgaatcctgatggcgca
gtaaattctgttgtggttggtgccaatgctgtttatataggaggactcttcagcaaaatc
acccttaacaatgccacccgtaatggtattgcagcacttgatataggcgggaatggtggt
gcccaacaaaactggaatgcaaatctttccggggcacaaatttacagtatcgtcgtcagt
gatcaggtttattttggaggattttattttaccccaagtttacaacaaaaatttattggg
gcagcaagtcttacaacgggcgcgcttaactctacttggagtgtcaacgcgaatgatatc
gtgagatctcttgccttgaatggaagtacaatgtacttaggcggcgacttcactactatc
agtggtgctgatgctaacaacaatacgattcaatatgatcgcaattatatagcagcggta
agtacgagtggtaaaggtattgttacagcttggaatcctgatgctgatgatgctgtctat
gcgcttgcattaagtgataatacactttatgcagcgggggccttttccaatattggttca
aaaagtcgttcaggtattgctgcgttaaatgctgacacgaatagcactggcagcgctact
tcatggactgccaatcttcttttacccggtattggttatgcaattgcattaagtgatagc
actgtctacataggcggtgattttaatagtgtaggcggttctcaatcgagtaattttgcg
attgttcctatgaggcttccatcgccctag

DBGET integrated database retrieval system