KEGG   Legionella longbeachae: LLO_3010Help
Entry
LLO_3010          CDS       T01183                                 

Gene name
ybiT
Definition
(GenBank) putative transporter fused subunits of ABC superfamily: ATP-binding components
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3503787..3505379)
Genome map
AA seq 530 aa AA seqDB search
MIALNQLGMAYGQRLLFYDVSLNLNSGLSYALVGANGCGKSTFFRLITGEEELTSGEIMM
PKDATIGWLKQDQFRYEDTLIKDIVLQGKPKLWQALSERETLMASDTWDDDKGFRFAALE
EIIAHYNGYSAEAEVETILLGLGIAKDYLQKPLKALSGGYKLRVLLAQTLFQHRSILLLD
EPTNHLDILSIRWLEKYLKNEYQGLVIFISHDMEFIDNLADYILDLDYGEIRQYRGNYAR
FLAEKNQLEEQKNLEKKSAEAKIAEMQKFVDKYKAKASKAGQARSRMKMIEKIEIPDVKH
SSRVAPHFHFAPKKISGKHVIKAENLSKSYKNKTLFKHLDFKVDRGEKVAIMGVNGIGKS
TLIKILTGMVQSDEGQVILGHEVRMSYFSQDHHELLNRHVSVFHWLSDVVSGVTEQQIRR
ALGQMLFVKEDVDKDILSLSGGEAARLLLAKTILESPNLLILDEPTNHMDLETIEALAQA
LVHYSGTVVFVSHNRHFVDKIATRILYFDPQTGVRDYKGCYVDFAQHYIG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgattgcattaaatcaattgggtatggcttatggccaacgtcttcttttttatgatgta
agcctgaatttaaattcaggacttagctatgcattggtgggcgcaaatggttgcggaaaa
tcaactttttttcggctgattactggagaggaggagttgacgtccggggaaattatgatg
cccaaggatgccacaattggctggttgaagcaggatcaatttcgttatgaagatacttta
attaaggatattgtcttacaaggaaagccaaaattatggcaggcattgtcggaacgtgaa
accttaatggcaagtgatacatgggatgatgataaaggctttcgttttgcagctttggaa
gagattatcgcgcattataatggatattcggcggaagcagaggttgaaaccattttatta
ggtttagggattgccaaagattatctgcaaaagccacttaaggcattgtcaggtggttat
aaattgcgtgttttattagcacaaactttatttcaacatcgttccattttattactcgat
gagccaacaaaccatttggatattttatccattcgttggttagagaagtatttaaaaaat
gaatatcaaggattagttatctttatttctcatgatatggaatttattgataatttagcg
gattatattttggatcttgattacggtgaaataaggcaataccgcggcaattatgcgcga
ttcctggcggaaaaaaatcagttggaagagcaaaaaaatcttgaaaaaaagagtgctgaa
gccaagattgcagagatgcaaaaatttgtagataaatataaagctaaagcttctaaagca
gggcaagcacgctcgcgcatgaagatgattgaaaaaattgaaattcctgatgtgaagcac
tcttccagggttgcaccgcattttcattttgcacctaaaaaaatatctggaaaacatgta
attaaagcagaaaatttgagtaaatcttacaaaaataagaccttattcaagcatcttgat
tttaaagtagaccgcggtgaaaaagtagcaattatgggtgttaatggaattgggaaatct
accttaattaaaatcttgacaggaatggtacagagtgatgaaggccaggttattttaggt
catgaagtacgtatgagttatttttctcaagatcaccatgaactactcaaccggcatgtg
agtgtctttcattggttatctgacgtagtgagcggtgtgaccgagcagcagatacgtagg
gcacttggtcaaatgttgtttgtgaaagaagatgtagataaggatattttatcactcagt
ggaggtgaggctgctcggctcttattggctaagactattttggaatcacccaatttatta
attcttgatgagccaacgaaccacatggatttggaaaccatagaggctttggcgcaggct
ttggttcattatagtggaacggttgtttttgtcagccacaatcgacattttgttgacaaa
attgcaacgagaatcttatatttcgacccgcaaacaggtgttcgtgattataaaggatgt
tatgtagattttgctcagcattatattgggtaa

DBGET integrated database retrieval system