KEGG   Legionella longbeachae: LLO_3015Help
Entry
LLO_3015          CDS       T01183                                 

Definition
(GenBank) putative HAD-superfamily phosphatase
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_3 Acid_PPase Swi3
Motif
Other DBs
NCBI-ProteinID: CBJ13464
Pasteur: llo3015
UniProt: D3HLY0
Position
complement(3509712..3511511)
Genome map
AA seq 599 aa AA seqDB search
MNEIKLIIWDLDDTLWKGTLADQDDVILNKEVIARIEYLLNRGIVHSICSKNDAKKAEKM
LKQLGIYEYFIFPKISFEDKGARIKKIIEQAQLREQNVLFVDDNEFVLREVLFHNPHIVT
KLIDQFMREDVSSWGKNDSNRERLAHYKILERKEKNKITFLEKNHDEHAFLKECNIKIQL
IPLDINDHEIERVIELVNRSNQMNYTQSRIKYEYLFTLFELKNGDNFKIRVEDKYGDYGV
VGYVCILNNTLFHYVFSCRILGMCVEARMYQWLKIMYPGLKYSFHTSKLKNVDINLDFIE
INLQQENKEKKFTPNSKKVLVRGPCLANAVSFLLSEHYHVDEEIFSFFEYANLHFLRENL
DGKQDIRFDKTRKAIERNEYHMIVNFLESDYYSGHYKIQSQKIPVTSNYIFWKSLKTIKY
DNQVLGEHIKTMMINGMRDIKRFNLDNRFSPWPRIEKIVNASLDWFGERWRKTLYQFIFY
FVFKNYRGYVSEKQFENNVLWYIGLFPEHVKLLFINPPEKIPLPFMTQEQNEKIVKRTQL
LNKIMRNIAKEKPNVLLLEMDDILEQDDIVDSFSHLKRKGYIKLSQLLLKTAKCSFSGN
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaattaaattaatcatttgggatttagacgatactttatggaaagggacatta
gcagaccaggatgatgtaatattaaataaagaagttattgcaagaattgaatatttgtta
aatagaggtattgttcattccatttgttcaaaaaacgatgcaaaaaaagcagaaaagatg
ctcaaacagttaggcatctacgaatattttatttttcccaagatatcctttgaagataaa
ggagcgcgaataaaaaaaattatagagcaagcacagcttcgtgaacaaaatgtattattt
gtagatgataatgagtttgttctacgagaggttctttttcacaacccccatatcgtaact
aaattgatcgaccaatttatgcgggaagatgtgagttcttggggaaagaatgacagtaat
cgggagcgcttggcacattataaaattctggaaaggaaagagaagaataaaataacattt
cttgaaaaaaatcatgatgagcatgcatttttgaaggaatgtaatatcaaaattcagctt
atccccttagatatcaatgatcatgagattgaacgcgtcatagagcttgtgaaccgttca
aatcagatgaattatacgcagtcccgtattaaatatgagtatttatttactttatttgaa
ttaaaaaatggggacaattttaaaatccgtgtggaagacaaatacggagattatggggtt
gtagggtatgtatgcattttaaataataccttattccactatgtgttttcatgtcgtatc
ctaggcatgtgtgttgaagcaaggatgtatcaatggttaaaaataatgtatcccggatta
aagtattcatttcatacgtctaaactaaaaaatgtagatataaatctggactttattgaa
attaatttgcagcaggaaaacaaagaaaaaaaatttactcccaatagtaaaaaagttttg
gtcagaggcccatgtcttgcaaatgctgtttcatttcttcttagtgaacactatcatgta
gatgaggaaatattttcattttttgaatatgcaaatttacattttttacgcgaaaattta
gacggcaaacaagatatacgtttcgataaaacacgaaaagctatagaaagaaatgagtac
catatgatcgttaactttcttgaaagcgattattacagtggccactataagatccaaagc
caaaagatccctgttacctccaattatattttctggaaaagtttaaaaacaatcaagtat
gacaatcaagtcttaggagaacatattaagacaatgatgattaatgggatgcgtgatata
aaacgatttaatcttgataatcgtttttctccgtggccacggattgaaaaaattgttaat
gcttcattagattggtttggagaacgttggcgaaaaacgctctatcagttcattttttat
tttgtatttaaaaattatcggggctatgtttctgaaaagcaatttgaaaataacgtgctc
tggtatattggtctttttccagaacatgtaaaactgttatttattaatcctcctgagaaa
atacccttgccattcatgacccaagaacaaaacgagaaaattgttaagcgtacccaactg
ctgaataaaattatgagaaatattgcaaaagaaaagccgaatgtattgcttttggagatg
gatgatattcttgaacaagatgatatcgtggacagcttttctcatttaaaaagaaaaggt
tatatcaaattatcacaattattattaaaaacagcaaaatgctctttttctggaaattaa

DBGET integrated database retrieval system