KEGG   Legionella longbeachae: LLO_3016Help
Entry
LLO_3016          CDS       T01183                                 

Gene name
RDH
Definition
(GenBank) Retinol dehydrogenase 8 (Photoreceptor outer segment all-trans retinol dehydrogenase)
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3511743..3512618
Genome map
AA seq 291 aa AA seqDB search
MTMINSKNEKVVLITGTSTGIGSSLALAFAHAGFQTIATMRNIDKAKALLDTAAQENVHL
DVRQLDVCDDQSVGLCVGGIQKDYGRIDILINNAGEGFHRTLEQASLDDIKRVMDVNFYG
VVRLTKAVLPSMRELQSGHIITISSLGGLIAVPFSEIYCAAKFAVEGMMEALAPIANALG
IHISLIEPGPVTTAFAGKLQQPHESNIAIYEELEQILRTNFLQHFPDGPQTGDEIARIVL
KAALSNKPKLRYVTSADGVNVASHKYVDINNSTYFELGKQLFATQEKELLG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgattaactctaaaaatgaaaaggttgtccttataactggaacttcaacaggt
ataggcagctctcttgccttagcctttgctcatgctggctttcaaaccatagcaaccatg
cgtaatatcgataaggctaaagcattgttagatacagcagctcaagaaaacgtacactta
gatgtccgtcaattagacgtttgcgatgatcaatcggttgggctttgtgttggcgggatt
caaaaagattatggccgcattgatattcttatcaataatgcaggagagggttttcataga
acattagaacaagcttcgctggatgacattaaaagggttatggatgttaatttttatggt
gtagttcgtcttactaaggcggtattgccttcgatgcgagagctccaaagtggacatatt
attacaatatccagtttaggaggtcttattgccgttccatttagtgagatttattgcgca
gccaagttcgctgttgaaggaatgatggaagcattggcaccaatcgcgaacgctttaggt
attcatatttcacttatagaaccagggcctgttactactgcttttgcaggaaaattgcag
caaccccatgaatcaaatattgctatatatgaagaactggaacaaattcttcgcacaaat
tttctgcaacactttcctgatggccctcaaactggagatgagattgcgcggattgtcctt
aaagcagcattaagcaataaaccaaaactacgttatgtaacctctgcggatggagtgaac
gttgcatctcataaatatgtggatattaacaacagcacctattttgaattggggaaacag
ctttttgcaactcaggagaaagaactgcttggctga

DBGET integrated database retrieval system