KEGG   Legionella longbeachae: LLO_3018Help
Entry
LLO_3018          CDS       T01183                                 

Gene name
argF
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
llo  Legionella longbeachae
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    LLO_3018 (argF)
Enzymes [BR:llo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     LLO_3018 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3514220..3515290)
Genome map
AA seq 356 aa AA seqDB search
MSLTIPVSNTIVEDNHSQTISEVTTNTFVINLQQAIFDLEVESQYTLGPDPKGGNASFTK
KSKHFLTGTELSTEELKRILEKAKALKQTPSFYNQALASKSLAMIFEKPSFRTRLSFAMA
IQSMGGIAIESIGNTRKQETPADMARVLNGYTDFIMVRTHADEILQEMAVHAKVPIINGL
SALHHPCQILADLLSLWEHFGSLDGLTIAYVGDGNNILHSLMLLAPQLGITINYCCPESR
QPNSAIIEQAQGIKSGMIHSFEKPEMAVKNVDAVYTDVWTSMGFESQDNSQVFQGFQVNE
SLMSYAKSGAVFMHCMPMERGKEVSEALPDSPASIIFTQSENRLHVQKALLLFLNL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttactattccagttagtaacactatagtagaagacaatcattcgcaaactatc
agcgaagttacaaccaatacgtttgtgattaatttacaacaggcgatttttgatcttgaa
gtggaatcccagtatacgcttggtcctgatcccaaaggaggtaatgcatcatttacaaaa
aaatcaaagcattttcttactggaacagaattaagtacagaagagttaaaacgtatttta
gagaaggctaaagcactgaaacaaaccccttctttttataaccaggctttagccagtaaa
agcctggccatgatttttgaaaaaccttcttttcgaacccgattaagttttgcaatggcg
attcaaagtatgggagggatagctattgaaagcataggtaataccagaaaacaagaaact
ccggcagatatggctagagttctaaatggttatacggactttattatggtgagaactcat
gcggatgagattttgcaagagatggctgttcatgcaaaagtacctataatcaatggtctt
tcagccctacatcatccatgccagatactcgctgatttattaagcctatgggaacatttt
ggttcgcttgatgggctaaccattgcatatgttggtgatgggaataatattcttcatagt
ttgatgttactggcacctcaattaggtataaccattaactattgctgcccggaatctcgc
cagccaaacagtgcaattatagaacaagcacaaggtattaaaagcggcatgattcatagt
ttcgaaaaacctgaaatggccgttaaaaatgttgatgcggtctataccgatgtatggacc
agtatgggttttgaatcccaggataatagccaggtatttcaaggattccaggtcaatgaa
tctttaatgtcttatgcaaagtcaggggcagtatttatgcattgtatgcccatggagcga
ggaaaagaagtctctgaggctttgccagacagcccagcttcaataatctttactcaaagt
gaaaacaggctgcacgtgcaaaaagcgttactgctgtttttaaatttatga

DBGET integrated database retrieval system