KEGG   Legionella longbeachae: LLO_3021Help
Entry
LLO_3021          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3517078..3518097
Genome map
AA seq 339 aa AA seqDB search
MDFTRIFFLIIFLLIGTIRETQAEETDQFTLPPKELQDIGPITSSRLYDVIKQVIAQTNS
EIQMLLPRIKRSRHAASQLALRQNGTYIADLVYKHTGPGFPRWLRRIPKESKPVFYKEAL
PWKTVYWLVFSQSPLFVIGLAPTINMYGYYFGTDKLGHFFMMGHTYYKIYMYYLNHGKSA
QKAHAAVVLYGQILEQTYLGTLINGVYSNADLAGNYAGWKFYMNLAQSVKIGERTLPPIL
VLNEGKWEFSKHVNRETLLKPYISDNLNEAFNPCRYTFMRSQIRRQVKKRCGDWIKRQGL
TQQIVQAKLEESSRWHGENYGHWLPEDNAVTLNACFGGQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggattttacaagaatcttttttttaattatatttttacttattggtacaatacgggaa
acccaagcagaagaaacggatcaatttacccttccccccaaggaattacaggacattggc
ccgatcacaagtagcagactttatgacgttatcaaacaagttattgctcaaaccaattca
gaaattcaaatgcttctaccaagaataaagcgtagccggcatgcagcatctcaattggca
ttacgccagaatggaacctatatcgcagatttagtttataagcatactggtccaggattt
cctcgttggttgcggcgtattcctaaagaatcaaaaccggtattctataaagaagccctc
ccatggaaaactgtttattggcttgttttttcccagtcgcctttatttgtaattgggctt
gcaccgacgattaatatgtacggttattatttcggtaccgacaagctaggtcattttttc
atgatgggccatacctactacaaaatttatatgtattacctgaaccatggaaaatctgcc
caaaaagctcatgctgccgtggttttatatggccaaatccttgaacaaacttatctggga
accttgatcaacggtgtttattccaatgcagatttagcaggaaattacgcaggatggaag
ttttatatgaatcttgcgcaaagcgtaaaaattggggagcgtactcttcctcctatttta
gttttaaatgaaggtaaatgggagttttccaaacatgtcaacagagaaactctgcttaag
ccttatatctcagataatttaaatgaggccttcaatccttgtcgttatacctttatgcgg
agtcaaattcgtagacaggttaaaaaacggtgtggcgattggattaaacgtcagggactt
acacaacaaattgttcaagcaaagcttgaagaaagcagccgatggcatggagaaaactat
ggccactggcttcctgaggacaatgccgtaacactcaatgcttgctttggaggtcaataa

DBGET integrated database retrieval system