KEGG   Legionella longbeachae: LLO_3026Help
Entry
LLO_3026          CDS       T01183                                 

Definition
(GenBank) putative MaoC-like dehydratase
  KO
K18290  
itaconyl-CoA hydratase [EC:4.2.1.56]
Organism
llo  Legionella longbeachae
Pathway
C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    LLO_3026
Enzymes [BR:llo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.56  itaconyl-CoA hydratase
     LLO_3026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3523203..3523721
Genome map
AA seq 172 aa AA seqDB search
MSNQSSYMSVGNNRIREDFGFYFEDFEIGQIIEHRPGRTITQNDNIWFTLLTMNTAQLHF
DAHYAEHTEWKKPLVNSTFTLAIITGMTVNTISKKVVANLEWDKVKLLKPVFEGDTIYAE
SEIKAKRESNSRPTQGIITVETRGINQHNELFMSFERTVLVYKRSGAPDYNI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcagagtagttatatgtccgtaggtaataaccgcatacgggaagattttggg
ttttatttcgaagattttgaaataggacaaattattgaacatagaccagggagaaccatt
acccaaaatgacaatatttggtttaccttacttacaatgaacacagcacaactgcatttt
gatgcacattacgcagaacataccgaatggaaaaaacctttagttaatagtacttttacc
ctggccattattacaggaatgaccgtcaatacaatctccaaaaaagtagtggctaatctt
gaatgggataaggttaaattgcttaaacctgtatttgaaggggatactatttacgctgaa
agcgaaataaaagcgaaacgggaatctaactcaagacccacccaaggcataatcactgta
gaaaccaggggtattaaccaacataatgaactttttatgtcctttgaacgaaccgtatta
gtgtataagagaagtggagcacctgattataacatataa

DBGET integrated database retrieval system