KEGG   Legionella longbeachae: LLO_3028Help
Entry
LLO_3028          CDS       T01183                                 

Definition
(GenBank) Hypothetical protein of unknown function
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3524565..3525707)
Genome map
AA seq 380 aa AA seqDB search
MRELFEKNAQNNDTSNSSQNTDICSSHLCMKSKLSIDEVREHLPALQSTMVDRRNPDLPG
SKPLMKAAKAHAILKAGTKINMLDATGIGEFELPSKCSIQITPPKEITIKATWKNKSQEK
GVSGRDASVFGGLGVLTIPCDVTVMNIPKMNALTVPPAFLDKYGAELIPLGKSFTLDAVQ
DRSLENLYLVEYQWDADYIQDYVMNQRGGGGLFVETHPFPHVFTPLSPECRGALILGVEN
RDGSFDFAAFEIPFGYTMKIGSNVIHGDSFFVGPYAIALTETELADSVLLKQDTPTRDIQ
KVTQIPTETFTVHLLEEDRLATEACHSMMVDKIRHGGGIGKGIGFFKQLPKEVLTKVRDL
SEDSQEAYDQHCGLVVYKPK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagagaacttttcgaaaaaaatgcccaaaataatgacacatctaattcttcacaaaat
acggatatttgtagcagtcacttatgtatgaaaagtaaattatcaattgatgaagtgaga
gaacatcttcctgctttacaatctactatggtcgatcgacgaaatcctgatcttccagga
agcaaaccattaatgaaagcagcaaaagctcatgctattcttaaagcaggtacaaaaatc
aatatgttggatgctacaggaataggtgaatttgagttaccttctaaatgttcgattcag
attactcctccgaaagaaataactataaaagctacttggaaaaataaaagccaggaaaaa
ggcgtaagtggccgcgatgccagcgtttttggcggtttgggagtattgactattccatgt
gatgttacagtgatgaatattcccaaaatgaatgcacttactgtgcccccagcattttta
gacaaatacggtgcggagctcattcccctgggaaaatcatttactcttgatgctgtacaa
gacagatctttagaaaatctttacttggttgaatatcaatgggacgcagattatattcaa
gactatgtgatgaatcaacgtggcggtggcgggttatttgtagaaacccatccttttcct
catgtttttacaccgctctctcctgagtgcagaggtgcattgatattgggagttgaaaat
cgggatggctcatttgattttgctgcttttgaaataccatttggctatactatgaaaatt
ggcagtaatgtgattcatggtgattcattctttgttggaccttatgcaatcgcattaact
gaaactgaattggctgactccgttcttttaaagcaagacacaccgactcgtgatatacaa
aaagttactcaaatacctaccgaaacatttacggttcatttgcttgaagaagataggttg
gcaactgaggcatgtcatagcatgatggttgataaaattcgtcatgggggcgggattgga
aaaggtataggattttttaaacagttacctaaagaggtattaactaaggttcgtgattta
tccgaggattctcaggaagcttatgatcaacattgtggtttggttgtttataaacctaag
taa

DBGET integrated database retrieval system