KEGG   Legionella longbeachae: LLO_3032Help
Entry
LLO_3032          CDS       T01183                                 

Definition
(GenBank) Similar to eukaryotic cytokinin oxidase
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_4 Cytokin-bind BBE
Motif
Other DBs
NCBI-ProteinID: CBJ13481
Pasteur: llo3032
UniProt: D3HLZ7
Position
complement(3528880..3530259)
Genome map
AA seq 459 aa AA seqDB search
MPQTKSKWNLFQIKQCNVKLGQALLHDEQALASFCEDFGKLTHSHPVAIFEPETTESAQL
LIQHAHANKLPVTLRGYGMSQSGQSLAVPGGVILNMKHFDSVADVDSHSIWVEANASWST
LLEKTLQQSLIPYVVPNNCNLSVGGVISAGGIGASSFKYGSVTAHVNALKIIQANGELIQ
VDSQSSLMQACLGGQGRFGLITQACIALRPCCKFIRTFFLVYLDKESWLNDLHLCRTKAD
FVESFCTPAIQGARLSEKGRLPFAQWLYAIHISIEYNDSAPDFSNLGLRPWRLIHTQDES
IHSYLHRHDSRFNAMKVTGQWDLQHPWYECFIPGSQLESLDELLDSLPIHYASVVHIASV
APVYPAGFLQLPKSNDIVALMILNPGLPTAFIPSCLQTIKYLDSILLPNGGKRYLSGYLG
KSLKTQFWKNHFEERYEDWIGLKKQYDPQNIFCSLLHRY
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaacaaagagcaagtggaatttattccagatcaagcagtgtaatgtaaaacta
gggcaagcgctgctccatgatgagcaggcgcttgcttcattttgtgaagattttggtaag
ctcactcactctcatccagtagccatctttgaaccggaaacaacggagtctgctcaatta
ttaatacaacatgctcatgcaaataaattacctgtgactttgcgtgggtatggaatgagt
caatctggacaatctcttgctgtacccgggggggtaattcttaatatgaaacactttgac
tccgtagcagatgtagattcccattccatatgggttgaagcaaatgcttcctggagtacc
ctattagaaaaaacattgcaacaatccttaattccttatgtagtacctaataattgcaat
ttatctgttggcggtgtgatttctgcagggggtataggcgcttcttcatttaaatatgga
agtgtgactgcacacgtaaacgcattaaaaattatccaggcaaatggagagctgatccag
gtagacagccaatcttcactaatgcaagcctgcttaggtggacaaggacgttttggcctc
atcactcaagcatgcattgcgttaagaccatgttgcaaattcatcaggaccttttttttg
gtctatctcgataaggaaagctggcttaatgatttacatttatgcagaacgaaagcggat
tttgttgagtccttttgcacacccgcaatacagggtgcaagactctcagaaaaaggtcgt
ctaccttttgcccaatggctttatgcgattcatatatccatagaatataatgattctgca
ccggatttcagcaatttaggattacgcccctggcgcttaatacatacccaagatgagtcg
attcattcgtatttacatcgccatgattcacgctttaacgcgatgaaagtcactggacaa
tgggacttacaacatccctggtatgagtgttttatacctggttcgcaattagagagttta
gatgaattgctggatagtttacccatacactatgcttctgtagtccacattgcctctgtc
gctccggtttatccggcaggttttttacaacttcctaaaagtaatgatattgttgcttta
atgatcttaaatcctggtctacccacggcattcattcccagctgtttgcaaaccatcaaa
tatttggattcaatccttttacctaatggagggaaacgttatctgtccgggtatttaggg
aaatccctaaaaacacaattttggaaaaaccattttgaagaacgatatgaagattggatt
ggcttaaaaaaacaatatgacccacaaaatattttttgttctcttttgcatcgttattga

DBGET integrated database retrieval system