KEGG   Legionella longbeachae: LLO_3036Help
Entry
LLO_3036          CDS       T01183                                 

Definition
(GenBank) Hypothetical protein, weakly similar to eukaryotic proteins
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein DUF1640 Baculo_PEP_C Sds3 Nbl1_Borealin_N RdRP_1 DUF5497 SF-assemblin Exonuc_VII_L Phage_Mu_Gam CorA ODR4-like Prominin Fib_alpha DUF1664 AAA_13 DUF883 Phasin TcpS GBP_C BshC AIP3 Oleosin Phage_GPO Helo_like_N PepSY_TM TipAS DUF4795 ATP-synt_B FdhE DUF1690 Allexi_40kDa FapA DUF3810 CEP19 DUF1451 HemX ALMT HAUS6_N
Motif
Other DBs
NCBI-ProteinID: CBJ13485
Pasteur: llo3036
UniProt: D3HM01
Position
complement(3535232..3535540)
Genome map
AA seq 102 aa AA seqDB search
MKILIKSLLCTVFLINTAFADELSQFNTQIQNQMKQMQTQQQQQMQQLNAQLQAQIKKVQ
ADLQQQIQTMNTQLQNQIKTSQSQLQTQIQTVNNQVQQLQKK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattctaataaaatcacttctttgtactgtctttttgattaataccgcttttgct
gatgagctatcacaatttaatacccaaattcaaaaccagatgaaacaaatgcaaacccaa
caacaacagcaaatgcaacaactcaacgcgcaactacaagcgcaaattaaaaaagttcaa
gctgacttacaacaacaaatacaaacaatgaacacccaattacaaaatcaaataaaaaca
agccaaagccaattacaaacacaaattcaaactgtaaacaaccaggtacaacaattacaa
aaaaaataa

DBGET integrated database retrieval system