KEGG   Legionella longbeachae: LLO_3037Help
Entry
LLO_3037          CDS       T01183                                 

Gene name
nudC
Definition
(GenBank) NADH pyrophosphatase
  KO
K03426  
NAD+ diphosphatase [EC:3.6.1.22]
Organism
llo  Legionella longbeachae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LLO_3037 (nudC)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     LLO_3037 (nudC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3535669..3536484)
Genome map
AA seq 271 aa AA seqDB search
MTTRFTSQLHPPTSCTETAFWFIFHGDELLLKNNSIPRLFAINELNLISEREIYLGLYGT
IPCFCVEINQKPIVLPPGMEFQHVRQSQEILEDDELFRLITRAKQLLHWDKSTQFCGYCG
HKTQLSSTERAKICPACNSLIFPQIAPVMLVLIWRNDEILLARSPHFLPGVYSVLAGFVE
PGEMLEHTVVREVQEEVGLTIKNLRYFSSQPWPFQSNLMLGFIAEYSYGEIQIDAVEIED
AQWFSIKKLPKLPKPISLSRQMIDQYLAMYR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacgattcacttcacaacttcatcctcccacttcatgtactgagactgcattt
tggttcattttccatggggatgagcttctgttaaaaaataactctatcccgcgtttgttt
gctattaatgaacttaatctcatcagtgagcgcgaaatttatttaggactttatggtact
ataccttgcttttgtgtagagattaatcaaaaacccatagttttacctcctggtatggaa
tttcaacatgttcgccaatctcaagaaattctagaagatgatgagttgtttcgattgata
acgcgtgcaaaacaattattacattgggacaaaagtactcaattttgtggatattgtggt
cataaaacccaattaagcagtacagaacgagctaaaatatgtcctgcgtgcaattcatta
atttttccccaaattgctccggttatgttggtattaatttggcgaaatgatgaaatctta
cttgcacgatcaccccattttttacccggagtttacagtgttttagctggctttgtggag
ccaggagaaatgcttgagcatacggttgtacgtgaagtacaggaagaggtaggactcaca
attaaaaacttgcgctatttttcctcgcaaccttggccttttcaaagtaatttgatgctg
gggtttattgctgaatacagttatggtgagatccaaatagatgcggttgaaattgaggat
gcgcaatggttttctataaaaaaactacctaaactaccaaagcccataagcctctcaaga
caaatgattgatcaatatttagcaatgtatcgctaa

DBGET integrated database retrieval system