KEGG   Legionella longbeachae: LLO_3039Help
Entry
LLO_3039          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3537235..3537480
Genome map
AA seq 81 aa AA seqDB search
MFSGEDLIKEDFQSILYRNGLSANEFKITIQNGSSYDPNQIVGTQVWITIEKNSIKKRYG
LYRTNWPDDFETDLKNGYFNI
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgtttagcggagaggatttaataaaagaagattttcaaagcattttatatcggaacgga
ctttctgctaatgagtttaaaatcacaatacagaatggctcaagttacgatccaaaccaa
atagttggcacacaagtttggataactatagaaaaaaattctataaaaaaaagatatgga
ttataccgaactaattggccagatgattttgaaacagatttaaaaaatggttactttaat
atttag

DBGET integrated database retrieval system