KEGG   Legionella longbeachae: LLO_3050Help
Entry
LLO_3050          CDS       T01183                                 

Gene name
yfdH
Definition
(GenBank) bactoprenol glucosyl transferase; CPS-53 (KpLE1) prophage
  KO
K20534  
polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
llo  Legionella longbeachae
Brite
Enzymes [BR:llo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     LLO_3050 (yfdH)
Lipopolysaccharide biosynthesis proteins [BR:llo01005]
 O-antigen
  LLO_3050 (yfdH)
Transporters [BR:llo02000]
 Other Transporters
  Others
   LLO_3050 (yfdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3548135..3549094
Genome map
AA seq 319 aa AA seqDB search
MAKSRDYTKRISCVVPVFNEEAGIAEFITALAETLKNLNYAYEILLVDDGSKDNTPAIIQ
QLRSHFVLRCIRFSRNFGKENAISAGLDHAQGDAVILLDADFQHPLELLSQFIAKWEDGY
DMVYAVRQNRTNESWIKRTCAKAFYQFTSRINRINIPANAGDFRLLDRKIVNALQKLPER
NRFMKGLYSWVGFKQIAIPFEVQPRKTGNSQWNFYSLLDLAITGITSFTAFPLRMIAIGG
ISVATIAILYGIWIILSTLIFGKETPGWATIVTTISFFGGLQLFALGVVGEYIGRVFDEV
KHRPHYIIDEESSFDDNIS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatcaagagattatacaaaacgtatttcctgtgtagttccagtttttaatgaa
gaagcaggaattgctgagtttattactgccctggctgaaaccctgaaaaacttaaattat
gcttatgaaatacttcttgtagacgatgggagtaaagacaacaccccagcaattattcag
cagttaagatctcattttgttttacgctgtattcgttttagccgtaattttggtaaagaa
aatgccataagtgcaggccttgaccatgcacaaggagatgctgttattttgctcgatgcc
gatttccaacatccccttgaacttttaagtcagttcattgcaaaatgggaagatggttat
gatatggtgtatgctgttcgccaaaatcgcacaaacgagtcatggataaagagaacttgc
gccaaagcattttaccaatttacttcacgaatcaaccgaattaatattcctgcaaatgct
ggcgactttagacttcttgatcgaaaaatagttaatgcgttgcaaaaactacctgagcgc
aatcgctttatgaaaggtttatacagttgggttgggtttaagcaaatcgcgattcctttt
gaagtgcaaccacgtaaaacaggtaactcgcaatggaacttctattctctgctggattta
gcgattaccggaattacctcatttactgcatttcccctgcgtatgattgctataggtggg
attagcgttgccacaatcgcaatactttatggcatctggattatactcagcaccttaatt
ttcggtaaggaaacaccgggatgggcaactattgttactactattagtttctttggtggt
ttgcaactttttgctttaggtgtggtaggtgaatatatagggcgcgtctttgacgaggtc
aaacacaggcctcactatattattgatgaggaatcaagttttgacgacaatatctcttag

DBGET integrated database retrieval system