KEGG   Legionella longbeachae: LLO_3052Help
Entry
LLO_3052          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
  KO
K09137  
uncharacterized protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3549566..3549898)
Genome map
AA seq 110 aa AA seqDB search
MNHVKISVYINERDKWQHRPLHLELLNMLDENGIAGGTVLRGVAGFTFKAPIVSTSLVDI
GSKLPLVVHFVDSIEKAELVLPKIKEMAKGRLITREIVEVISGAHFDIKE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgtaaaaatttctgtctacattaatgaaagggataaatggcagcatcgcccc
ttacatcttgaattattaaatatgcttgatgaaaatggaattgcaggtggaacggtattg
cgtggggtagctggatttacgtttaaggctcctattgtatctacatcgttagttgatatt
ggaagcaagctccctttagtagtgcatttcgtagattcaatcgaaaaagcagaattggta
ttacctaaaatcaaagaaatggctaaaggtcgacttattactcgtgaaattgttgaagtg
attagtggtgcacattttgatataaaagagtag

DBGET integrated database retrieval system