KEGG   Legionella longbeachae: LLO_3053Help
Entry
LLO_3053          CDS       T01183                                 

Gene name
crcB
Definition
(GenBank) Protein crcB homolog
  KO
K06199  
fluoride exporter
Organism
llo  Legionella longbeachae
Brite
Transporters [BR:llo02000]
 Other Transporters
  Pores ion channels [TC:1]
   LLO_3053 (crcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3549900..3550274)
Genome map
AA seq 124 aa AA seqDB search
MNDIFWISCGAIIGANLRYLVNRFSIKYLSADIPYGTFLVNITGSFILGFFLVWTLERVE
VDPRWRSFVAVGFCGAYTTFSSFSYETYRLIEQSDYALAALNFICNNLFSLLAVIAGIVL
ARAI
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgatattttttggatctcatgcggagcgattattggagcgaacttacgttattta
gtgaatcgcttttctattaaatatttatcagcagatatcccctatggaacttttctcgtt
aatattacaggcagtttcattcttggtttttttcttgtttggactttagagcgtgtagaa
gttgatcccagatggagatcatttgttgctgttggcttttgtggtgcttatacaacgttt
tcgagtttcagttatgaaacgtatcgacttatagagcaaagtgattatgctcttgctgcg
ctaaattttatttgcaataatcttttttctctacttgcagtaattgcgggcatagtgctc
gctcgggcaatttga

DBGET integrated database retrieval system