KEGG   Legionella longbeachae: LLO_3056Help
Entry
LLO_3056          CDS       T01183                                 

Gene name
yggV
Definition
(GenBank) dITP/XTP pyrophosphatase
  KO
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
llo  Legionella longbeachae
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LLO_3056 (yggV)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     LLO_3056 (yggV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3552460..3553047
Genome map
AA seq 195 aa AA seqDB search
MKKIVLATSNAGKIKELNTLLTPIECIPQATLGISDAVENGLSFIENALIKARHASLYAN
EPALADDSGLVVPALNGDPGIYSARYAGSHATDVENINLLLENMSHLTSEHREAWFYCAI
ALVQHAKDPTPIITTGICKGFIHDNPAGEGGFGYDPIFYLPEYQCTMAQLPAKLKNNISH
RAQALKQLRNYIQNL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgttcttgcaaccagtaacgctggtaaaattaaagagttaaatacttta
ttaacccctattgaatgcattcctcaggccactttggggatttcagatgctgtagaaaat
ggcttaagcttcatagaaaatgcgctaatcaaagctcgtcatgcgagtttgtatgcaaac
gaacctgctttagcagatgattcaggtttagtagtacctgctttaaatggagatccaggt
atttattctgcgcgttatgccggcagccatgcaaccgatgttgaaaacatcaatctttta
ttagaaaacatgagtcatctgaccagtgaacatcgagaagcatggttttattgtgcgatt
gctttagtccaacatgcaaaagatcccacaccaatcatcacaactggaatttgtaaagga
tttattcatgataatccagcgggtgaagggggttttggctatgacccaatattttatctc
cctgaatatcaatgcacgatggctcaattacctgctaaacttaaaaataatatcagtcat
cgtgcacaagctttaaaacaactgcgtaactatattcaaaacttataa

DBGET integrated database retrieval system