KEGG   Legionella longbeachae: LLO_3057Help
Entry
LLO_3057          CDS       T01183                                 

Definition
(GenBank) putative Protein with TPR motifs (protein-protein interaction motif)
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3553210..3554910
Genome map
AA seq 566 aa AA seqDB search
MNIEALFAQAYKFQYEGQLPQAISIYEQILTKEPGHLNSLHFLGLIYAQLGDMDNAILYL
LQALSISPNDVSLLNNLANAYKKTHLLDKAIEYYQRAIQLDPEYAQAQNNLATVYAMQNN
YSKALFHYTKAVHAEPDFSAAHFNLGLLLLQNNQLEAAKTQFNNVISLNPLHTESLFYLG
VLHLEKNDLFEAENAFQNVLKQDDKQIEALSNLGVIALKRHQNQLAVDFFTRALALDNDN
TEARNNLAATFMHHDRFENALMHYDVLLQKDPDNLEYLYNSGVAQMALGHLNEAILHFEH
ITRLESKHTSTLNNLAAIYIKMDQKEKAQEYLERALEINPKDTISAHMLHAIKGDRHAQT
TPEYAHNLFNNYALYYDQHMKGALHYSVPQHIARTIHQLELPINIHTLDLGCGTGLTGIV
LREVSKYLVGVDIAAKMLAQAKEKEIYDNLFESEINQFLLQNKNFYDLIVAADVLPYFGE
LEALFHSIHLHLKRQGYFIFTAEISTSTHWHLETSARFSHHPDYIAQLAKQNNFHLLKQE
KIPARKQNNQPLEVMLYVLKNATWLN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaagcactttttgcgcaagcatacaaattccaatatgaaggccaactccca
caagccattagcatttatgagcaaatattgaccaaagaacccggacatttgaatagcttg
cattttttagggcttatttacgctcaattaggggatatggataatgcgattctatactta
ttacaagccctttcaatcagtcccaatgatgtcagtttgcttaacaatttagctaatgcc
tataaaaaaacacatctactggataaggctattgaatattatcagcgtgcaatacaactt
gatccagagtatgcacaagcacagaacaatcttgcaacggtttatgctatgcaaaataat
tattcaaaagcattattccattataccaaagcagttcatgctgaacccgattttagtgct
gcacactttaatttaggtttattattactccaaaacaatcaattagaagcagcaaaaact
caattcaataatgtgatctctttaaatccgttacacacagaatctcttttctatttaggt
gtcttgcatttagaaaaaaatgatctttttgaagctgaaaatgcttttcaaaatgttttg
aaacaggatgataaacaaatagaagccctttcgaatttaggcgtaattgcattaaaaagg
catcaaaatcaattagcagttgattttttcacgagagcattggctctagacaacgacaat
accgaagcgcgtaataatctggctgcaacattcatgcatcacgaccgttttgaaaatgct
ctcatgcattatgatgttttactacaaaaagatcctgataaccttgaatatttatacaat
tcaggtgtggctcaaatggcattaggacatttgaatgaagcaattcttcattttgagcat
attacgcggttagaaagcaagcatacttccacattaaataatttggccgcaatttatatt
aaaatggaccagaaagaaaaggcacaagaatatttggaacgcgctttagagattaatcct
aaagatacaatcagcgctcatatgctccatgccataaaaggggatagacatgcacaaact
acccctgaatatgctcataacttatttaataattacgcactgtattacgatcaacatatg
aaaggcgcccttcattactcggtgcctcaacatattgcacgtacaatccaccagctggaa
ttaccaatcaatattcataccctggacctcggatgcggaacggggttaactggcattgtg
ctccgcgaagtgagcaaatatttagtaggggtcgatattgcagcaaaaatgttggctcag
gctaaggaaaaagaaatttatgataatttattcgagtcagaaataaatcaatttcttttg
caaaacaaaaatttttatgatttgattgtggctgctgacgtccttccctatttcggagaa
cttgaggccttatttcattccattcatttacacctaaaacgccaaggttattttattttt
actgcagaaataagcacttctactcattggcacctcgaaacaagcgctcgttttagccat
catcctgattatatagctcagttagctaagcaaaataactttcatttactaaaacaggaa
aaaattccagcacgaaaacaaaataatcaacctcttgaagtcatgctgtacgtattaaaa
aatgctacttggctcaattga

DBGET integrated database retrieval system