KEGG   Legionella longbeachae: LLO_3064Help
Entry
LLO_3064          CDS       T01183                                 

Gene name
radC
Definition
(GenBank) DNA repair protein RadC (start is missing)
  KO
K03630  
DNA repair protein RadC
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3561610..3562185
Genome map
AA seq 191 aa AA seqDB search
MQLACDLLAHLGDLRAILNADTQSFKQVKGLGEAQYVQLQAVKEICRRSDFIQIQKENQI
TNSKQTYVYLKKRLRDYKNETFVALFLDNQHRIIAYDELFSGTINTATIHPRPIIERVLR
LNAAALILAHNHPSGVSDPSPQDIAVTERMREALELVDVRLLDHIIIGDNEVYSIIAEAK
WICHEQLALYN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagttagcatgcgaccttctcgctcatttaggtgatttacgtgccatccttaatgca
gacacacaaagtttcaaacaggtaaaaggattaggagaagctcagtatgtccagttacaa
gcggtaaaagaaatatgccgacgtagtgattttattcaaatccaaaaggaaaaccaaatt
actaatagcaaacaaacatatgtctatttaaaaaaacgtttacgtgattataaaaatgaa
acatttgttgcattgtttctagataatcaacaccgcattattgcttatgatgaacttttc
tccggaaccattaataccgcaacgattcacccaaggccaatcatagagcgagttcttaga
cttaatgctgcggcattaatacttgcgcacaatcacccatcaggtgtatctgatcccagc
ccccaagatatagcagtaacggagcgcatgcgtgaagcgttagagttagttgatgtgcga
ttgttggatcatatcattattggagataatgaagtttattccatcattgcggaagctaaa
tggatttgtcatgagcaattagctctttataactga

DBGET integrated database retrieval system