KEGG   Legionella longbeachae: LLO_3071Help
Entry
LLO_3071          CDS       T01183                                 

Gene name
sufC
Definition
(GenBank) component of SufBCD complex, ATP-binding component of ABC superfamily
  KO
K09013  
Fe-S cluster assembly ATP-binding protein
Organism
llo  Legionella longbeachae
Brite
Transporters [BR:llo02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Orphan ABC ATPase
    LLO_3071 (sufC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3567073..3567822)
Genome map
AA seq 249 aa AA seqDB search
MLKIKDLNVSVNGQAILKGIDLQVNAGEVHAIMGPNGSGKSTLSKVLAGHPSYQVTDGEI
SYLEQDLNPLSPEERARAGVFLSFQYPVEIPGVTNINFLKASVNAVRKGQGKNTLDAIEF
LTFIREKCQLLEMDESFLYRSINEGFSGGEKKRNEILQMAALEPKLAILDETDSGLDIDA
LRIISHGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLVNGRIILSGDKSLALELEKKG
YSWLEETVQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaattaaagacttaaatgtttcggtgaatggacaagccattttaaagggtatt
gatcttcaagtgaatgctggtgaagttcatgcaattatgggcccgaatggttctggtaaa
agtaccttatctaaagttttagctggtcatccttcttatcaagtcactgatggtgagatt
tcctatttggaacaagacctgaatcctttgtctccagaagaaagagcgcgtgccggagtt
tttctatcttttcaatatccggtagaaatacctggagtgaccaacattaattttcttaaa
gcttctgtgaatgcggtgcgtaaaggccaagggaaaaatacacttgatgctattgaattt
ttaacgttcattcgtgaaaaatgccagttgctcgaaatggatgagagttttttataccgt
agtatcaatgaaggattctcaggaggagaaaaaaagcgtaatgaaattttacagatggca
gccctagagcctaagcttgcaattctcgatgaaacagattcaggtttagatattgatgca
ttgcgtattatttctcatggtgttaatgcgatgcgatctcctgagcgctccattatttta
gtgacccattatcaacgcttacttgattacattgaaccggactttattcatgtgttggtt
aatgggcgtattattctttcaggcgataaatcccttgctcttgaattagagaaaaaaggg
tacagctggcttgaggaaacggtgcagtga

DBGET integrated database retrieval system