KEGG   Legionella longbeachae: LLO_3075Help
Entry
LLO_3075          CDS       T01183                                 

Gene name
icmF
Definition
(GenBank) Hypothetical protein of unknown function
  KO
K12210  
intracellular multiplication protein IcmF
Organism
llo  Legionella longbeachae
Brite
Secretion system [BR:llo02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   LLO_3075 (icmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3571261..3574182
Genome map
AA seq 973 aa AA seqDB search
MDNSLRALCDAIKKILSQLKPQNHPLSFIVITGKNAQGKSALLKQSNMEEIPVFSEQHAK
VYFNQQGIMIELGENWLTNSKSLLFNTLKQLNRCNSYLKITGIVLCIDVNDLLIADPAQF
AEQKKAHLQLIERFGINLGYPVEFALIFTKMDTLAGFTEFYQSEHATDLAKPLGFSLDCM
NDPKKKKEAYALQFNQLIEQLNQQVIHKMHPARSTMRRSLIREFPLQVASLGTPIHALIH
GISTKLFHLHSIYFTSAEQGGISIDRLNKKIQHEYALVVQDTFPQATNFRAYFVEGALKT
IQEHCSQIPQLRKFSQKTIISSTASIVGIALLILSYNYYKTAHLLDEASKELLAYDVLIN
QQDKQNQALYHLSNAAQTMSHIPSNSLSLPTVHQLKNNLQNTSDNRLYGDFLYSLTNELE
EVINNPSNTPIIRYNALKIYLMLSQPEHFSTIQVHDWFASNWKDQPEITLKKHLTLLKRV
LNKPPKNITIKQQVITDARNYLNALPTSYLFYSIAKESFPATKQQISINGFVLATNELPV
YFTRAGFDDVIKIIPEINHTLQKENWVLARNDLGQLQDMLIQAYCFDYVTWWQTFMRKSQ
PFHYQDYQAGRQVVKTLEQSHALSKIIGLIQQETKADLTNNSSPFNQFIASQFTDLNLMS
HSSTQELSLKIVDLERFISTLSMINDNGKTAFNITRTRFASDNASDPVSLLYNQAKLLPA
PLSIWSKQLASDAWSILIKDSRQYINQQWQQTVFRDFQTTIAQRYPFDSSQKEEISIHDF
NRFFSTHGTLNTFTENYVKPFLDISSAEWKPKAINDTVIPITSETLDALIRANIITNMFF
PDRGEESKINFSLQKISLDPIVANLELQIGQTKLTDNQGSDSMTHFTWPQANAKLALDSI
EGNHYELAEQGVWALFKLLEKVNVLIDEQDSSNLQILFEVNSNSGRYLLKTNNQVNPFTP
GILNGFNLEEYIV
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggacaactctttacgcgcattgtgtgatgctataaaaaaaatactttcccaattaaaa
ccccaaaaccatccactctcttttatagtgattacgggaaaaaatgcacaagggaaatct
gccttgttaaaacaaagcaacatggaggaaatacctgtctttagcgaacaacatgcaaaa
gtctattttaatcagcaaggaatcatgattgagttaggtgaaaattggttaacgaacagc
aaaagcctcttattcaataccctaaaacagttaaatcgttgtaactcatatctaaaaatt
actggcatagtgttatgtattgatgtaaacgacttactgattgccgatcccgcacaattt
gctgaacaaaagaaagcacacctgcagttgatagaacgatttggtattaatttaggttat
cccgttgagtttgctctgatatttactaaaatggatactttagccggctttactgagttt
tatcaatcagagcatgcgaccgatttagcgaaacctcttggattttctctggattgcatg
aatgatcccaagaaaaagaaggaagcttacgccttacaatttaatcaactgattgaacaa
ctaaatcaacaagtcattcataagatgcaccctgcacgctccacgatgagacgtagttta
attcgtgagtttccattgcaggtggctagcctgggtaccccgattcatgcattaatacat
ggaatttcaacaaaactgtttcatttgcattccatttattttacgagcgcggaacaaggc
ggtatcagtattgatcgcctcaataaaaaaattcagcacgaatatgcattagtcgttcaa
gatacttttcctcaagcaaccaatttcagagcctattttgttgagggagccttaaaaaca
atccaggaacattgcagccaaattccacaactacgtaagttttcgcaaaaaaccattatc
tcatcaacagcgagtattgttggaattgccctgcttatattaagttacaattattataaa
acagcgcacttactggatgaagcgagcaaagaattacttgcctatgatgtacttattaat
caacaagataaacaaaatcaggctctttatcatttatcgaatgctgcacagacaatgagc
catattccaagtaactctttatccctgccaactgtgcaccagctaaaaaataatttgcaa
aacactagcgataaccgactctacggtgattttttatactcgctaacgaatgagctcgaa
gaagtgattaataatccgagtaatacaccaattattcggtataatgcattgaaaatttac
ctaatgcttagccagccagaacatttttctacaatacaagtccatgattggtttgcttcg
aattggaaagatcaaccagaaatcaccttaaaaaaacatttgaccctgttaaaaagggtc
ttaaataaaccaccaaaaaatataacaatcaaacagcaagtcattactgatgcacgcaat
tatcttaatgctttgcctacaagttatctattttactctattgccaaagagtcttttcct
gcaacgaaacaacaaatatcaattaatggatttgttttagctacaaatgaattgcctgtt
tattttactcgagcaggttttgatgatgtaataaaaataattccagaaataaaccataca
ttgcaaaaagaaaactgggtccttgcacgtaatgatttagggcaattacaagatatgctt
attcaagcctattgctttgattatgtcacctggtggcaaacatttatgcgtaaatcacaa
ccgtttcattatcaagattatcaagctggacgccaagtcgttaagactttagaacaatcg
cacgcattaagtaaaatcataggactaattcaacaagaaactaaggcagatttgaccaat
aactcttcgccttttaatcagtttattgccagccaatttactgacttgaatttgatgagc
cattccagtacccaagaactcagcttaaaaatcgttgatttggaacgctttatttctact
ttatccatgataaatgataatggaaaaactgcatttaatatcacgagaacacggttcgct
agtgacaatgcatcagatccggtaagcctactctataatcaggcaaaacttttacctgca
cctttaagtatttggtccaaacaattagcaagtgatgcctggagtattttaatcaaagac
agtcgccaatatattaaccaacaatggcaacaaactgtctttcgagattttcaaaccacc
atcgcccaacgttatccgtttgactcgtctcaaaaggaagaaatatcgattcatgatttt
aatcgattcttctccactcatggaacgttaaacacgtttactgaaaactacgtaaaacct
ttcctggatatttcaagtgcagaatggaagccaaaagcgattaacgataccgtgatacca
atcacctcggaaacattagatgcattgatacgagccaatatcattacaaatatgtttttc
cccgatcgcggtgaagaaagcaaaattaacttcagtttgcaaaaaatcagccttgatccg
atagttgcaaacttggaactacaaatcggccaaactaaattaacagataatcaaggaagt
gactcgatgactcactttacctggccccaagcaaatgccaaacttgctcttgactctatt
gaagggaaccattacgaactcgctgaacaaggagtatgggctttattcaaacttctagaa
aaggtaaatgttcttattgatgaacaagatagctccaatttacaaattcttttcgaagtg
aacagcaattctgggcgctatttattaaaaacaaataatcaggtgaatcccttcactccc
ggtattttaaatggctttaacctggaagaatatattgtttaa

DBGET integrated database retrieval system