KEGG   Legionella longbeachae: LLO_3084Help
Entry
LLO_3084          CDS       T01183                                 

Definition
(GenBank) putative two-component response regulator
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3581988..3582377)
Genome map
AA seq 129 aa AA seqDB search
MPKELKKILYAEDEEDIRAIAQIALEDIGDFTVRYCSNGKEVIDAAKEFIPDLLLLDVMM
PEQDGPTTLCELRKNPEFMEIPAIFMTAKIQSDEIAEYKSIGAIDVIKKPFDPLTLAMSI
NNAWLKYNG
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagaacttaaaaagattttatatgctgaagacgaagaggacataagagctatt
gctcaaatcgctttggaagatatcggcgattttacggtaaggtattgttctaatggtaaa
gaggttatagatgcagcaaaggagtttattcccgatttacttttattagatgtaatgatg
cctgaacaggatggaccaaccactttatgtgaattaaggaagaatcctgagtttatggaa
atacctgctatatttatgactgctaaaatacaaagtgatgaaatagcagaatataagtct
ataggagcaattgatgtaattaaaaagccttttgatcctttgactcttgcgatgtcaata
aacaatgcctggttaaaatataatggatga

DBGET integrated database retrieval system