KEGG   Legionella longbeachae: LLO_3086Help
Entry
LLO_3086          CDS       T01183                                 

Definition
(GenBank) putative coiled coil protein, weakly similar to eukaryotic proteins
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
complement(3585127..3586419)
Genome map
AA seq 430 aa AA seqDB search
MTNAKQINSLLAIIRDEKNSIKERSFALKKLESEINTPALEDEVDFEASFSAFEQQWSQF
EETMSVFTNGFEDVDDEVNQLIQHEGETIRREKKDNTSSSSEKIDTEIKDLERRLQDLHD
FSMDDLERRLHSLHQFKVESHERKPNVLNVPIKTLEKKLSLFEAPDEKSHQVEPSDPLNV
SGLDKDDTPYVPRNSINLPTAPVQITVIPKVDKMNIFAVFINQFKALIQSAGYFIKKLGN
KSISLPEATEKLNITQAQLGFSMGKLNDATNYFRNIRDELATQHKILSREFAKYSQMGKN
IPKIKVLLKQIKSSNDVDKDKKIKDLEGRLLSYESLGSDIRKMTHQLNKVNQNASAVYKN
LQNTALMHEMATKRVTTAMKELEQVLDREELIKNQHRIKDVLSDYRKESEKVKKLMDSVE
EISIPSYPKR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgcaaagcaaattaatagtttacttgccataattcgtgatgaaaaaaactct
atcaaagagcgtagttttgcgctcaaaaaattggaaagtgaaattaataccccggcttta
gaagacgaggtagattttgaagccagtttttctgcgtttgaacaacagtggtcgcaattt
gaagaaacgatgtctgtttttacaaatggttttgaagatgtcgatgatgaagtgaatcaa
ctaatacagcacgagggagagacgatacgtcgggaaaaaaaggataacacaagctcttcg
tcagaaaaaatcgatactgaaattaaagatctggaacgtagactccaagatttacatgac
ttttccatggatgatcttgaaagaaggcttcacagtttacatcaatttaaagttgaaagt
catgaaagaaagccgaacgttttgaatgtgcctattaaaacactggaaaaaaagctaagc
ttatttgaggctccagatgagaaaagtcatcaagtggaaccgtctgaccctttaaatgtc
agtggtttggataaagacgatacgccgtatgtacctcgaaacagcattaatttaccaacg
gctcccgttcaaataacagttatcccaaaagttgataaaatgaatatctttgctgttttt
attaatcagttcaaagcactcatacaatcagcgggatattttataaaaaaattaggtaat
aagagtatttctttgccagaagccactgaaaaacttaatatcactcaagcgcaattaggt
ttctcaatgggaaaattaaacgatgcgacaaattatttcagaaatataagggatgaactt
gctacgcagcataaaattctttcaagggagtttgctaaatacagtcaaatgggtaaaaac
attcctaaaataaaggtattgctgaaacaaataaaatcaagtaacgacgttgataaggac
aaaaaaatcaaagatcttgaaggccgcctcttaagttatgagagcttgggaagtgatata
aggaaaatgacccatcagttaaacaaagttaaccaaaatgcgagtgctgtttacaaaaat
ttgcaaaatactgcgctcatgcatgaaatggcaacaaaaagagtcactaccgcaatgaag
gagctggagcaagtgctagaccgagaagagttaataaaaaaccaacatcgaataaaagat
gtgctatctgactatcgcaaagaatctgaaaaagttaaaaaactaatggattcagtagaa
gaaatatcgataccatcttatcccaagcgttaa

DBGET integrated database retrieval system