KEGG   Legionella longbeachae: LLO_3091Help
Entry
LLO_3091          CDS       T01183                                 

Gene name
yhiN
Definition
(GenBank) putative oxidoreductase with FAD/NAD(P)-binding domain
  KO
K07007  
uncharacterized protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3592559..3593734
Genome map
AA seq 391 aa AA seqDB search
MEEVDVIIIGAGAAGLMCAIEASKRGRKVLVLDHANKAGKKILMSGGGRCNFTNYYIEPE
KYKSNNPHFFKSALTRYTQWDFIELVKKHRIPFHEKTLGQLFCDNKSIDIVTMLLKECDN
AGVTIRLNTTIEKIHKTLSFKIQTTKGNFHCQSAVIASGGLSIPTMGASPFAYKIAEQFG
IKVWPTRAGLVPLTLDVAEKEKIALLSGIGVDSLVKNACIEFREHTLFTHRGLSGPAILQ
LSSYWNVGQTICINLLPEINLLEHLKAARVNKPQKQLNSILSTLLPKRVIDVFIKPDLAE
KKLAELSNRDLESVAKQLNSWIVKPNGTEGYRTAEVTIGGIDCNSISSKTMESHDVSGLY
FIGEALDVTGWLGGYNFQWAWSSGWAAGQVV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgatgttattattattggcgcaggtgccgccggactaatgtgtgccatt
gaagcaagcaaacgcggccgtaaagttttagtgcttgatcatgccaataaagcaggaaaa
aaaattttgatgtctggtggaggacgttgtaatttcaccaattactatatagaacccgaa
aaatacaaatccaataatcctcatttttttaaatcggctttaacccgatatacccaatgg
gattttatcgaactggtaaaaaagcataggattcctttccatgagaaaactctgggacaa
ctcttttgtgataataaatcaatagatattgttactatgctgcttaaggaatgtgacaat
gcaggagttacaatacggttaaacacaaccattgaaaaaattcataaaacactgagtttt
aaaatccaaaccaccaagggtaattttcattgtcaatccgcagttattgccagtggtgga
ttatccatacctaccatgggagcgagtccttttgcctataagattgccgaacaatttggg
attaaagtatggccaacaagggcgggacttgttcctttaaccctggatgtagctgaaaaa
gagaaaatcgcattgctttcaggaattggagttgatagtttggttaaaaatgcttgtatt
gaatttcgtgagcataccttatttacccaccgaggtctgagtggacctgcaatcttacag
ttatcttcctattggaacgttggtcaaacaatctgtatcaatttattacctgagattaat
cttttagaacatttaaaagccgctcgcgtcaataaaccacaaaaacaattaaattcgata
ctatccacactcttacccaagcgcgtcatcgacgtctttattaaaccagatcttgcagaa
aaaaaattagctgaactttcaaaccgggacttggaatctgttgcaaaacaacttaattca
tggatcgtaaaacccaatggcacagaaggatatagaactgcagaagtaacgattgggggg
atagattgtaattccatttcatcaaaaaccatggagtctcatgatgtatctggcctttat
ttcattggcgaggcccttgatgtaacgggttggttaggaggatataattttcaatgggca
tggtcatcaggctgggctgcaggccaggtagtataa

DBGET integrated database retrieval system