KEGG   Legionella longbeachae: LLO_3171Help
Entry
LLO_3171          CDS       T01183                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
llo  Legionella longbeachae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LLO_3171 (galU)
   00052 Galactose metabolism
    LLO_3171 (galU)
   00500 Starch and sucrose metabolism
    LLO_3171 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LLO_3171 (galU)
Enzymes [BR:llo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LLO_3171 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3713347..3714249
Genome map
AA seq 300 aa AA seqDB search
MKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVTEAVLAGIKDIVLVTHSSKNSI
ENHFDTSFELEATLEKRVKRGLLEEICSIIPSDISLMHIRQGEAKGLGHAILCARPCIGA
EPFAVLLPDVIINPYLSNLKQDNLAAMIARFHETQINQVMVEPIPREMLAHYGVIDSKGK
HLKPGETTEIFNLIEKPTPESAPSNLSIVGRYVFSPAIWPLLEQIEPGVGEEIQLTDAIV
KLINYEPVEAYHIVGKSHDCGNKVGYVLTNIEFALHHPEVSSAVRHAIRAKAMQLDREKV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtaattccagttgcaggtcttggcacaaggatgcttccagcaaccaaagct
attccaaaggaaatgcttcctctcgttgataagccgttgattcaatacattgttaccgaa
gccgttttagctggaatcaaggacattgtgctggtaacccattccagtaaaaattcgatt
gaaaatcattttgataccagttttgaattagaggctactttagaaaaacgagtcaagcgt
ggcttgttagaggaaatatgctctattattccatcagatatctctttaatgcatattcgc
cagggagaggctaaaggtttggggcatgccatattatgcgcacgcccatgcattggtgct
gagccttttgcagtattgctccccgatgttattattaatccgtacctgtcaaatttaaag
caagacaatcttgcagcaatgattgcccgatttcatgaaacccagattaatcaagtcatg
gtggaaccaatccccagggaaatgcttgctcactatggtgttattgacagcaaaggcaaa
cacttgaaaccaggagaaacaacagaaatttttaacctcatagaaaagccaactcctgaa
agcgctccttccaacctttcaattgttggccgctatgtattttcacctgccatttggccg
ctcctggaacaaatcgagcccggagtgggagaagagattcaactaacagacgctattgtc
aagcttatcaattatgaaccggttgaagcctatcatattgtggggaagagtcatgattgc
ggcaataaagtaggatatgtgcttacgaatattgaatttgcgctgcatcacccggaagtt
tcctcagcagttcgtcatgcaattcgcgccaaagcaatgcaattagatagggagaaagtt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system