KEGG   Legionella longbeachae: LLO_3171Help
Entry
LLO_3171          CDS       T01183                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
llo  Legionella longbeachae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:llo00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:llo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:llo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:llo00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3713347..3714249
Genome map
AA seq 300 aa AA seqDB search
MKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVTEAVLAGIKDIVLVTHSSKNSI
ENHFDTSFELEATLEKRVKRGLLEEICSIIPSDISLMHIRQGEAKGLGHAILCARPCIGA
EPFAVLLPDVIINPYLSNLKQDNLAAMIARFHETQINQVMVEPIPREMLAHYGVIDSKGK
HLKPGETTEIFNLIEKPTPESAPSNLSIVGRYVFSPAIWPLLEQIEPGVGEEIQLTDAIV
KLINYEPVEAYHIVGKSHDCGNKVGYVLTNIEFALHHPEVSSAVRHAIRAKAMQLDREKV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtaattccagttgcaggtcttggcacaaggatgcttccagcaaccaaagct
attccaaaggaaatgcttcctctcgttgataagccgttgattcaatacattgttaccgaa
gccgttttagctggaatcaaggacattgtgctggtaacccattccagtaaaaattcgatt
gaaaatcattttgataccagttttgaattagaggctactttagaaaaacgagtcaagcgt
ggcttgttagaggaaatatgctctattattccatcagatatctctttaatgcatattcgc
cagggagaggctaaaggtttggggcatgccatattatgcgcacgcccatgcattggtgct
gagccttttgcagtattgctccccgatgttattattaatccgtacctgtcaaatttaaag
caagacaatcttgcagcaatgattgcccgatttcatgaaacccagattaatcaagtcatg
gtggaaccaatccccagggaaatgcttgctcactatggtgttattgacagcaaaggcaaa
cacttgaaaccaggagaaacaacagaaatttttaacctcatagaaaagccaactcctgaa
agcgctccttccaacctttcaattgttggccgctatgtattttcacctgccatttggccg
ctcctggaacaaatcgagcccggagtgggagaagagattcaactaacagacgctattgtc
aagcttatcaattatgaaccggttgaagcctatcatattgtggggaagagtcatgattgc
ggcaataaagtaggatatgtgcttacgaatattgaatttgcgctgcatcacccggaagtt
tcctcagcagttcgtcatgcaattcgcgccaaagcaatgcaattagatagggagaaagtt
taa

DBGET integrated database retrieval system