KEGG   Legionella longbeachae: LLO_3193Help
Entry
LLO_3193          CDS       T01183                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
llo  Legionella longbeachae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LLO_3193 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LLO_3193 (proB)
Enzymes [BR:llo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LLO_3193 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3743189..3744256
Genome map
AA seq 355 aa AA seqDB search
MKIVIKVGTQSILSSDGTPFEPIMLHLVEQVVTLQKAGHQVILVSSGAVASGRKVARQFF
DRQYGSSIGEKQVLASLGQYELMHIYASMFKKYNMLASQLLLTKQDFQTRQHYLNISRLL
REILEHKNIVPIINENDSVAIAELMFTDNDELSGLIAAMINADKLIILSNVEGVYTKHPN
EADSELISMIHPKNDWPEVSAVKSLHGRGGMISKLGTARRMSNLGVTTHIASINQHEVIM
RILSEESLGTTILPTKKRSNIKRWIAYGENKLGTITINTRLVEIIKENKRVISILPVGIE
KFTGDFKRGDLVEILTPNNEKIGIGLAKYDAIKLNEYLGHSAKPEFIHYDHLHIF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagttatcaaagtcggaacccaaagtattttatcaagtgatggcactccattt
gagcctattatgctccatttagtggagcaggttgtcacgcttcaaaaagcaggccaccag
gttatattggtaagttcaggtgcggtcgcttcgggtcgaaaagtggcacgtcaatttttt
gaccgccaatacgggagttcgataggagaaaaacaggttttagcatcattggggcaatat
gagctgatgcatatttatgcttcgatgttcaaaaaatataatatgcttgcctctcaattg
ttgcttacaaaacaagattttcaaacaagacaacactatttgaatatttcacggttacta
cgtgaaattttagagcataagaatattgtacccattatcaatgagaatgatagtgttgct
attgcagaattgatgtttactgataacgacgaattatcgggtcttatagccgcaatgatt
aatgcggataaactcataattttgagtaatgtggaaggggtatacacaaaacaccccaat
gaagccgactcagaacttatttccatgatccatcccaaaaatgattggcctgaagtttct
gcggtaaaaagtcttcatggcagaggcgggatgattagcaagcttggaacagcacgcagg
atgtctaatctgggagtaaccacacacatagcgagcatcaatcaacacgaagtgataatg
cgcatccttagtgaagaatctttgggtactactattttacctactaaaaaaagatcaaat
ataaaaagatggattgcttatggtgaaaataaattaggaacaatcactataaatactcgc
cttgtcgaaattataaaagaaaataaacgggttatcagtatattacctgtagggattgaa
aaatttactggcgattttaagcgaggcgacttagttgaaatactgactcccaataatgaa
aaaatagggattgggcttgctaaatacgatgcaattaaattaaatgaatatttaggccac
tccgcaaaaccggaatttattcattatgatcatttacatattttttaa

DBGET integrated database retrieval system