KEGG   Legionella longbeachae: LLO_3211Help
Entry
LLO_3211          CDS       T01183                                 

Definition
asparagine synthetase, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
llo  Legionella longbeachae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:llo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3768146..3769930
Genome map
AA seq 594 aa AA seqDB search
MCGIAGEFQFNKKNIPLFNLEKALLKQINRGPDDGQIYLTKNMALGHRRLKIFDLSNRGM
QPMVNSDLGLALVFNGAIYNFVALREVLKSKGYSFDSNSDTEVLLKAYHAWGKDCVLRLC
GMFAFAIWEQHTGKLILARDRLGIKPLYYSSDAYHGFKFASTLPALIEFGDIDTSIDKVA
LHYYLTFHAVPDPLTILSGVKKLPPGSIMTVHPDGQIEEKRYWKLTFDNTKADHYHDENY
WVKETYEALKSATHRQLAADVPVGILLSGGLDSSLLVAMASKLGHQKIQTFSIGFDSSKE
EQGDEFLYSNLVASKFNTQHQQLFISNKQLAYSLGNCISAMSEPMLSHDNIGFYLLSHEV
AKHVKVVLSGQGADEIFAGYHWFQNIHLHPTLPSQSAQIIFNKVADRSFKEYQQLVTLDF
QTTFHASDFLIKLCEENNSKNPIDNLLKYESTFALANGPLSRVDNMTMAASLEARVPFLD
EKMLELATSMPIQFKLPQGGKYILKKLGKKILPKQIVERPKGYFPVPALKYLEGSTLELM
RDVLSPDKIKQRGIFNSQAIQNLFTNSTKNFTPSGISKLWQVGLLEYWLQQHHI
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcgctggagagttccaattcaataaaaaaaacattcctctttttaatctg
gaaaaggctctgctgaagcagatcaaccgagggcctgatgatggtcaaatatatcttaca
aaaaatatggcccttggacacagacggctgaaaatatttgatctctctaatcggggtatg
cagcccatggttaattcggatttaggcttggcgctcgtatttaatggagcaatctataat
tttgtagcactgcgcgaagttttaaaatcgaagggatactcctttgattcaaatagtgat
acggaagtgcttcttaaagcgtaccatgcctggggaaaagattgcgtgcttcgcctttgt
ggtatgtttgcttttgcaatctgggaacaacatacaggcaaattaatacttgcacgggat
cgcctgggcattaaacctctgtattacagctcagatgcatatcatgggttcaaattcgcc
tccaccctacctgccctaattgaatttggtgatattgatacctcgatcgataaagttgcg
cttcattattatctcacgtttcatgctgttccagatccattgaccattttatccggtgta
aaaaaacttcctccaggctctataatgactgtccatcctgatggtcaaatcgaagaaaag
cgttattggaaattaacttttgataatacaaaagctgatcattatcatgatgaaaactac
tgggtaaaagaaacctatgaagcgttaaaatcagcaacccaccgccaattagcggcagat
gtccccgttggtattttactttcaggtggattggattcttccttgctcgttgccatggca
tccaaacttggacatcaaaaaattcaaacattctctattggatttgatagctccaaggag
gaacagggagatgagtttttgtactcaaacctagttgcttcaaagtttaatacacaacat
cagcaactgtttatttcaaataaacagttagcttattccttggggaattgtatttctgca
atgtcagagcctatgctcagtcatgacaatattggattttatcttctttctcatgaagtg
gccaaacatgttaaggtagtcctttcaggccaaggagcagacgagatttttgcgggatat
cattggtttcaaaatatacatttacatccaacattaccttctcaatcagcacaaattatt
tttaacaaagtagctgatcgctcttttaaagaatatcagcagctcgtaacccttgacttt
cagacaacatttcatgcttctgattttttgattaaactgtgtgaagagaataactcgaaa
aatccaattgataatctccttaaatatgaaagcacctttgcattggcaaatggaccatta
agccgggttgataatatgaccatggcagcaagccttgaggcaagagtaccttttttggat
gaaaaaatgcttgaactcgctacttctatgccgattcaatttaaattgcctcaaggcggt
aaatacattttgaaaaagcttggaaagaaaatactaccgaaacaaattgtagagcgccct
aaaggatattttcctgttccagcattgaaatatttagaaggaagtactttagagctcatg
cgtgacgtactttcccctgacaagataaaacaaagagggatttttaattcacaagcaatt
caaaatctatttacaaattccacaaaaaattttacaccctcaggtatttccaagctgtgg
caagtgggcttgctggaatattggttacaacaacatcacatataa

DBGET integrated database retrieval system