KEGG   Legionella longbeachae: LLO_3273Help
Entry
LLO_3273          CDS       T01183                                 

Gene name
acsB
Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLO_3273 (acsB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_3273 (acsB)
   00620 Pyruvate metabolism
    LLO_3273 (acsB)
   00640 Propanoate metabolism
    LLO_3273 (acsB)
  Energy metabolism
   00680 Methane metabolism
    LLO_3273 (acsB)
Enzymes [BR:llo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LLO_3273 (acsB)
Lipid biosynthesis proteins [BR:llo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LLO_3273 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3842041..3843921
Genome map
AA seq 626 aa AA seqDB search
MHAHLRPPQLAQTEDTLTEFWSEIAQQTLDWLRPWDTVLTGGLQHGDVTWFKGGKLNASL
NCLDRHLPYKANHPAIIWEGDDPDQNKTLTFATLHAEVCRMSNVLKQFNVKKGDKVAIYL
PMIPEAAIAMLACTRIGAVHTVIFAGFSAQALKQRVLASECRCIITANHFYRGGKLVGLK
EHIDEACKDLSLPRIIIKTSNDPVAFDNNKDHWWHELKEKVSDQCDPEPMDAEDPLFILY
TSGSTGQPKGVVHTTAGYLVQTAYTHQLLFNCQDNDIFWCTADVGWVTGHSYLVYGPLCN
GITTLIYEGIPTWPDPSRNWQIIDKYQVNVFYTAPTAIRALMRAGDDWLASSTRSSLRLL
GSVGEPINPEAWQWYYQKVGQKRCPIIDTWWQTETGAIMISPRADEPDSKPGAARQPIPG
VIPVLLNEHGHEITGAGEGYLAIKYPWPSMARTIAGDHHRYCSTYLHHGYYITGDGAKRD
EEGDYWITGRVDDVINVSGHRLGTAEIESALVSHPAVAEAAVVGIPHELKGQGIYAFVIL
RDGFTANDALKTELIKQVNQEISPIAKPDIIHFTHDLPKTRSGKIMRRILRKISGKEIQS
LEELGDISTLANPQIVAQLWEESAQF
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcatgctcatttacgcccccctcaactagcacaaacagaagatactttgactgaattt
tggtcggaaattgcgcaacaaactttggattggctacgcccctgggatacagtattgact
ggtgggttgcaacatggtgatgtgacctggtttaaaggtgggaaactaaacgccagctta
aattgcctggataggcatcttccctataaagcaaatcatcctgcaattatttgggaggga
gatgatccagaccaaaacaagacattaacttttgcaacattacatgctgaagtatgccgc
atgagcaatgtactcaaacaattcaatgtaaaaaaaggggataaagtcgcgatctaccta
ccgatgatccccgaagcagcaatagctatgctcgcttgtacccgaattggcgcagtacat
accgtcatatttgcaggtttttctgcccaggctttaaagcaacgtgtactcgcatcggaa
tgccgctgtatcattacagcaaaccacttttaccgcgggggtaaattagtaggattaaaa
gagcatattgatgaagcgtgcaaggatttatccttacccagaattatcattaaaaccagt
aatgaccctgttgcttttgataacaataaagatcactggtggcatgagttaaaagagaaa
gtaagtgatcaatgcgatcctgagcctatggatgccgaagatcctttatttatcctttat
acctcaggtagtaccggacaacctaaaggggtagttcatactacagcgggttatctggta
caaacagcctacacccatcagttgctctttaattgtcaggataatgacatcttttggtgt
accgctgatgttggctgggttactggtcatagctatttagtgtatggccctctttgcaat
ggcatcaccacgcttatctatgaggggattcctacctggcctgatccttccagaaactgg
caaatcattgataaataccaagtgaatgtcttttataccgcacctactgctatacgcgct
ttaatgcgtgcaggagatgactggctcgcatccagcacccgcagttctttacgcttgctg
ggttcagtaggagaacccattaatccagaagcctggcaatggtattatcagaaagtaggc
caaaagagatgcccaataatagatacttggtggcaaacagaaactggggcgattatgatt
agtcccagagctgatgaaccagacagcaaacctggcgctgcccgccaacccattccgggg
gttattccagtgctactcaatgagcatggccatgaaataaccggagctggtgaaggatac
ctggctataaaatatccatggccatctatggcgcgaaccatcgcaggagatcaccatcgc
tattgtagcacctatttacatcatggttattacatcaccggtgatggcgccaagcgtgac
gaagagggggattattggatcactggccgtgtggatgatgtgattaatgtttctggtcat
cgcttaggtactgcagaaattgaaagtgcgttggtaagccaccctgcagttgcagaagca
gctgttgttgggatacctcatgagttaaagggtcaaggaatttatgcttttgtcatttta
agggatggtttcactgcgaatgatgctttaaaaactgagttaatcaaacaagtgaatcaa
gaaataagccctatagccaaaccagacatcatccattttactcatgacttaccaaaaaca
cgatcaggtaagattatgcggcgaattttgcgcaaaatttcaggaaaagaaattcaaagt
cttgaagaattaggtgatatttcgactttagcaaaccctcagattgttgcgcaattatgg
gaagaatcggcacaattttaa

DBGET integrated database retrieval system