KEGG   Legionella longbeachae: LLO_3273Help
Entry
LLO_3273          CDS       T01183                                 

Gene name
acsB
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:llo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:llo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:llo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:llo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:llo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3842041..3843921
Genome map
AA seq 626 aa AA seqDB search
MHAHLRPPQLAQTEDTLTEFWSEIAQQTLDWLRPWDTVLTGGLQHGDVTWFKGGKLNASL
NCLDRHLPYKANHPAIIWEGDDPDQNKTLTFATLHAEVCRMSNVLKQFNVKKGDKVAIYL
PMIPEAAIAMLACTRIGAVHTVIFAGFSAQALKQRVLASECRCIITANHFYRGGKLVGLK
EHIDEACKDLSLPRIIIKTSNDPVAFDNNKDHWWHELKEKVSDQCDPEPMDAEDPLFILY
TSGSTGQPKGVVHTTAGYLVQTAYTHQLLFNCQDNDIFWCTADVGWVTGHSYLVYGPLCN
GITTLIYEGIPTWPDPSRNWQIIDKYQVNVFYTAPTAIRALMRAGDDWLASSTRSSLRLL
GSVGEPINPEAWQWYYQKVGQKRCPIIDTWWQTETGAIMISPRADEPDSKPGAARQPIPG
VIPVLLNEHGHEITGAGEGYLAIKYPWPSMARTIAGDHHRYCSTYLHHGYYITGDGAKRD
EEGDYWITGRVDDVINVSGHRLGTAEIESALVSHPAVAEAAVVGIPHELKGQGIYAFVIL
RDGFTANDALKTELIKQVNQEISPIAKPDIIHFTHDLPKTRSGKIMRRILRKISGKEIQS
LEELGDISTLANPQIVAQLWEESAQF
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcatgctcatttacgcccccctcaactagcacaaacagaagatactttgactgaattt
tggtcggaaattgcgcaacaaactttggattggctacgcccctgggatacagtattgact
ggtgggttgcaacatggtgatgtgacctggtttaaaggtgggaaactaaacgccagctta
aattgcctggataggcatcttccctataaagcaaatcatcctgcaattatttgggaggga
gatgatccagaccaaaacaagacattaacttttgcaacattacatgctgaagtatgccgc
atgagcaatgtactcaaacaattcaatgtaaaaaaaggggataaagtcgcgatctaccta
ccgatgatccccgaagcagcaatagctatgctcgcttgtacccgaattggcgcagtacat
accgtcatatttgcaggtttttctgcccaggctttaaagcaacgtgtactcgcatcggaa
tgccgctgtatcattacagcaaaccacttttaccgcgggggtaaattagtaggattaaaa
gagcatattgatgaagcgtgcaaggatttatccttacccagaattatcattaaaaccagt
aatgaccctgttgcttttgataacaataaagatcactggtggcatgagttaaaagagaaa
gtaagtgatcaatgcgatcctgagcctatggatgccgaagatcctttatttatcctttat
acctcaggtagtaccggacaacctaaaggggtagttcatactacagcgggttatctggta
caaacagcctacacccatcagttgctctttaattgtcaggataatgacatcttttggtgt
accgctgatgttggctgggttactggtcatagctatttagtgtatggccctctttgcaat
ggcatcaccacgcttatctatgaggggattcctacctggcctgatccttccagaaactgg
caaatcattgataaataccaagtgaatgtcttttataccgcacctactgctatacgcgct
ttaatgcgtgcaggagatgactggctcgcatccagcacccgcagttctttacgcttgctg
ggttcagtaggagaacccattaatccagaagcctggcaatggtattatcagaaagtaggc
caaaagagatgcccaataatagatacttggtggcaaacagaaactggggcgattatgatt
agtcccagagctgatgaaccagacagcaaacctggcgctgcccgccaacccattccgggg
gttattccagtgctactcaatgagcatggccatgaaataaccggagctggtgaaggatac
ctggctataaaatatccatggccatctatggcgcgaaccatcgcaggagatcaccatcgc
tattgtagcacctatttacatcatggttattacatcaccggtgatggcgccaagcgtgac
gaagagggggattattggatcactggccgtgtggatgatgtgattaatgtttctggtcat
cgcttaggtactgcagaaattgaaagtgcgttggtaagccaccctgcagttgcagaagca
gctgttgttgggatacctcatgagttaaagggtcaaggaatttatgcttttgtcatttta
agggatggtttcactgcgaatgatgctttaaaaactgagttaatcaaacaagtgaatcaa
gaaataagccctatagccaaaccagacatcatccattttactcatgacttaccaaaaaca
cgatcaggtaagattatgcggcgaattttgcgcaaaatttcaggaaaagaaattcaaagt
cttgaagaattaggtgatatttcgactttagcaaaccctcagattgttgcgcaattatgg
gaagaatcggcacaattttaa

DBGET integrated database retrieval system