KEGG   Legionella longbeachae: LLO_3303Help
Entry
LLO_3303          CDS       T01183                                 

Gene name
cheB
Definition
fused chemotaxis regulator ; protein-glutamat (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
llo  Legionella longbeachae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:llo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LLO_3303 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    LLO_3303 (cheB)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     LLO_3303 (cheB)
Two-component system [BR:llo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   LLO_3303 (cheB)
Bacterial motility proteins [BR:llo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LLO_3303 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3877431..3878486
Genome map
AA seq 351 aa AA seqDB search
MIKILIVDDSPTETALIQHIIESAKDMEVIGVAKNGKEAIELNKKLKPNLITMDIHMPVM
DGLEATRIIMAHHPTPIVIISSLINSESAQASFHILDAGALTALEKPQNVFSPSFEDSKN
HIIDTLRSLADIRVVKKPLKRHLTHGSFLAHAKHTSEPLYEIIAMGASIGGPIALKTILS
QLPADFPVPIVIVQHMSSGFICGFAQWLAENIALTVKNAENYETLKAGVVYIAPEHKHLE
IDKAHKNLICKLVDAPPVSGFCPSITHLFQSIARVSRERAIGVLLTGMSDDGATGLLELK
QAHGHTLIQDQESSVVFGMGAVAQSLNAVDKVIELENIAGYLTKICTITSE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaattttaattgttgatgactcacctacagaaacggcactaatccaacatatc
attgagtctgccaaggatatggaagtgattggcgtcgccaaaaatggcaaggaagcaatt
gagttaaacaaaaaattaaagcccaaccttattacgatggatatacatatgccagtcatg
gatgggctagaggccactcgtatcattatggcccatcatcctacaccaattgtgatcatt
agttccctgataaatagcgaatctgcccaagctagctttcatattctcgacgcaggcgca
ttaactgccctagaaaaaccgcaaaatgtattttcaccttcttttgaagacagcaaaaat
catatcattgatactcttcgtagccttgcggatattcgagtagtaaaaaagccactaaaa
aggcatttaacacacggcagtttcctggcgcacgccaagcatacgagcgagcccctttat
gaaattattgctatgggggcctccattggtggtcccatagcattgaaaactattctctcc
caattaccagcagatttccctgtacctatcgtaattgtgcaacatatgagtagtggtttt
atatgcgggtttgctcaatggcttgcggaaaatatagcgcttaccgttaaaaatgcagaa
aattatgaaaccttaaaagcaggagtagtttacatagcccctgagcataaacatctggag
atcgataaagctcataaaaatttaatctgcaaattagtggatgctccccctgtttccggt
ttttgcccttcaattacgcatttatttcaatcaatcgccagggtttccagagaaagagcc
attggtgtgcttttaacgggaatgagtgatgatggcgcaacaggattattggaattaaaa
caagctcatgggcatactttgatccaagaccaagaaagctctgttgtgtttggcatgggt
gctgtagcacaatcattaaacgccgtagacaaagtaattgaattagagaatattgcaggt
tatttaacaaaaatttgtaccattacaagcgagtaa

DBGET integrated database retrieval system