KEGG   Legionella longbeachae: LLO_3303Help
Entry
LLO_3303          CDS       T01183                                 

Gene name
cheB
Definition
fused chemotaxis regulator ; protein-glutamat (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
llo  Legionella longbeachae
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:llo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:llo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3877431..3878486
Genome map
AA seq 351 aa AA seqDB search
MIKILIVDDSPTETALIQHIIESAKDMEVIGVAKNGKEAIELNKKLKPNLITMDIHMPVM
DGLEATRIIMAHHPTPIVIISSLINSESAQASFHILDAGALTALEKPQNVFSPSFEDSKN
HIIDTLRSLADIRVVKKPLKRHLTHGSFLAHAKHTSEPLYEIIAMGASIGGPIALKTILS
QLPADFPVPIVIVQHMSSGFICGFAQWLAENIALTVKNAENYETLKAGVVYIAPEHKHLE
IDKAHKNLICKLVDAPPVSGFCPSITHLFQSIARVSRERAIGVLLTGMSDDGATGLLELK
QAHGHTLIQDQESSVVFGMGAVAQSLNAVDKVIELENIAGYLTKICTITSE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaattttaattgttgatgactcacctacagaaacggcactaatccaacatatc
attgagtctgccaaggatatggaagtgattggcgtcgccaaaaatggcaaggaagcaatt
gagttaaacaaaaaattaaagcccaaccttattacgatggatatacatatgccagtcatg
gatgggctagaggccactcgtatcattatggcccatcatcctacaccaattgtgatcatt
agttccctgataaatagcgaatctgcccaagctagctttcatattctcgacgcaggcgca
ttaactgccctagaaaaaccgcaaaatgtattttcaccttcttttgaagacagcaaaaat
catatcattgatactcttcgtagccttgcggatattcgagtagtaaaaaagccactaaaa
aggcatttaacacacggcagtttcctggcgcacgccaagcatacgagcgagcccctttat
gaaattattgctatgggggcctccattggtggtcccatagcattgaaaactattctctcc
caattaccagcagatttccctgtacctatcgtaattgtgcaacatatgagtagtggtttt
atatgcgggtttgctcaatggcttgcggaaaatatagcgcttaccgttaaaaatgcagaa
aattatgaaaccttaaaagcaggagtagtttacatagcccctgagcataaacatctggag
atcgataaagctcataaaaatttaatctgcaaattagtggatgctccccctgtttccggt
ttttgcccttcaattacgcatttatttcaatcaatcgccagggtttccagagaaagagcc
attggtgtgcttttaacgggaatgagtgatgatggcgcaacaggattattggaattaaaa
caagctcatgggcatactttgatccaagaccaagaaagctctgttgtgtttggcatgggt
gctgtagcacaatcattaaacgccgtagacaaagtaattgaattagagaatattgcaggt
tatttaacaaaaatttgtaccattacaagcgagtaa

DBGET integrated database retrieval system