KEGG   Legionella longbeachae: LLO_3307Help
Entry
LLO_3307          CDS       T01183                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
llo  Legionella longbeachae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLO_3307
   01230 Biosynthesis of amino acids
    LLO_3307
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_3307
  Energy metabolism
   00680 Methane metabolism
    LLO_3307
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLO_3307
Enzymes [BR:llo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LLO_3307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3881896..3882534
Genome map
AA seq 212 aa AA seqDB search
MATRLLVARHGNTFAPGDVVRRVGTTDLSLVASGLNQGRLLGVYLKQQHLIPDVIFTSKL
KRAIQTAEQAQLTMGSDLPIETLSIFNEIDYGPDENQPEENVIARIGKDAMSAWETQAIV
PQGWSVDPDTLIKNWLDFSIHLRTNYMGKTCLVITSNGVARFLPHLTGNFAAFTGQYGIK
IATGALCIFENKEHSELWDCIAWNVKPQIMSF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctacacgattacttgtcgcccgtcatggaaacactttcgcccctggcgatgtggtc
cgccgagtaggcactactgatttatctttagtggcaagcggcttaaatcaaggccgttta
cttggtgtttacctaaagcaacagcatcttatccctgatgtgatttttacctcaaaatta
aaacgcgccatccagacagcagaacaagctcagctcactatgggctctgatttgccgatt
gaaaccttgtccattttcaatgaaatcgattatgggcctgatgaaaaccaaccagaagag
aatgtaattgctcgaattggaaaagatgcgatgagcgcttgggaaacccaggctatagta
ccccaaggttggagtgttgatcccgatacactcattaaaaattggctggatttttctatc
catcttcgcacaaattatatggggaaaacatgtttggtcatcaccagtaatggagttgcc
cgttttttacctcatttaacaggtaattttgcagcattcactggacaatatggaattaaa
attgctacaggagcattatgcatctttgaaaataaagaacattctgaactttgggattgt
atcgcctggaatgtaaagccgcagattatgagtttttag

DBGET integrated database retrieval system