KEGG   Lactococcus lactis subsp. cremoris A76: llh_0200Help
Entry
llh_0200          CDS       T01965                                 

Definition
Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llh_0200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llh_0200
   00020 Citrate cycle (TCA cycle)
    llh_0200
   00620 Pyruvate metabolism
    llh_0200
Enzymes [BR:llr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     llh_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46198..47784)
Genome map
AA seq 528 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEEGTTVEVDSPLVEFDGDGSGTSAAAPSAQETASSDAPSGNAQIFTMPDIGEGMHEGDI
ANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYNGN
GESSSNPAPAASPAPIAEAPKTAAAPTDAPLTKTTSTGHILAMPSVRHYARKAGIDLTQV
PATGRHGHTTLADVKAFESGSVAPIAPVAPESAPVAPAPKADKATEKAPTVKSVAGDRRE
AMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEVAAKQDIKLTYLAYVAK
ALATTAHKFPEINASVDYDKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILEIAKE
IAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKEPIVN
GEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggggacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgatccaattgctgaagtacaa
aatgataaactcatgcaagaaattctctctccctactctgggactgtaacaaaactcttc
gttgaagaaggaacaactgtagaagttgattctcctttggttgagtttgatggagacggt
tcaggaacttctgcagctgctccttccgctcaagaaacagcaagttctgatgctccttct
ggcaatgctcaaatcttcaccatgcctgatattggtgaaggaatgcatgaaggcgatatt
gccaactggctcgttaaagttggagatgaaattaaagaagatgatcctgttgcagaagtt
caaaacgataaactcatgcaagagattctttctccttactctggaaaagtcacaaaactt
ttcgtcgaagcaggaacaactgtagaagttggtgctcctttgattgaatacaatggaaat
ggtgaatcttcaagtaatcctgctcctgctgctagtcctgcgccaattgcggaagctcct
aaaacagccgctgcacctactgatgcgccattgacaaaaacaacttctactggacatatt
cttgctatgccatctgtccgtcattatgctcgtaaagcgggaattgatttgactcaagta
cctgcaactggtcgtcatgggcatacaactttggctgacgttaaagcttttgaatctggt
agcgttgcaccaattgctcctgtggctccagaatcagctcctgtggcacctgcgcctaaa
gctgataaagctacggaaaaagccccaactgttaaatctgtggctggagatcgtcgtgaa
gcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaacacactcatatt
ccaccagtaacaaactttgatcaagtggaagtttctaaacttgttaaacatcgcgccgtc
ttcaaagaagtagcagcaaaacaagatatcaaattgacttaccttgcttatgttgctaaa
gccttggcaactactgctcataagttcccagaaattaatgcttctgttgactatgataag
caagaaattgtttatcatgaacatgtcaacctcgggattgctgtaaatgccccaactggt
ttatatgtcccagtcattcatgaagctgaaactaaatcaatccttgaaattgcaaaagaa
attgctgaattagcgactgctacacgtgaaggaacgcttaaacctcaacaaatgcaaggc
tcaacgattacaatttcaaatattggttctgctcgtggttcttggtttacaccaatcatc
aacggttctgatgttgtgattttaggtttgggttcaattgttaaagaaccaattgtcaat
ggtgaaggtgaaattgtcgtaggacaaaacatgaaattgtctatgacttatgaccaccgt
ttgattgatggtatgttgggtcaaacatcacttaactacttgaaatcacttttggctgac
cctgagttcatgcttatggaaatttaa

DBGET integrated database retrieval system