KEGG   Lactococcus lactis subsp. cremoris A76: llh_0200Help
Entry
llh_0200          CDS       T01965                                 

Definition
Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:llr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:llr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:llr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:llr00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(46198..47784)
Genome map
AA seq 528 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEEGTTVEVDSPLVEFDGDGSGTSAAAPSAQETASSDAPSGNAQIFTMPDIGEGMHEGDI
ANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYNGN
GESSSNPAPAASPAPIAEAPKTAAAPTDAPLTKTTSTGHILAMPSVRHYARKAGIDLTQV
PATGRHGHTTLADVKAFESGSVAPIAPVAPESAPVAPAPKADKATEKAPTVKSVAGDRRE
AMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEVAAKQDIKLTYLAYVAK
ALATTAHKFPEINASVDYDKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILEIAKE
IAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKEPIVN
GEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggggacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgatccaattgctgaagtacaa
aatgataaactcatgcaagaaattctctctccctactctgggactgtaacaaaactcttc
gttgaagaaggaacaactgtagaagttgattctcctttggttgagtttgatggagacggt
tcaggaacttctgcagctgctccttccgctcaagaaacagcaagttctgatgctccttct
ggcaatgctcaaatcttcaccatgcctgatattggtgaaggaatgcatgaaggcgatatt
gccaactggctcgttaaagttggagatgaaattaaagaagatgatcctgttgcagaagtt
caaaacgataaactcatgcaagagattctttctccttactctggaaaagtcacaaaactt
ttcgtcgaagcaggaacaactgtagaagttggtgctcctttgattgaatacaatggaaat
ggtgaatcttcaagtaatcctgctcctgctgctagtcctgcgccaattgcggaagctcct
aaaacagccgctgcacctactgatgcgccattgacaaaaacaacttctactggacatatt
cttgctatgccatctgtccgtcattatgctcgtaaagcgggaattgatttgactcaagta
cctgcaactggtcgtcatgggcatacaactttggctgacgttaaagcttttgaatctggt
agcgttgcaccaattgctcctgtggctccagaatcagctcctgtggcacctgcgcctaaa
gctgataaagctacggaaaaagccccaactgttaaatctgtggctggagatcgtcgtgaa
gcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaacacactcatatt
ccaccagtaacaaactttgatcaagtggaagtttctaaacttgttaaacatcgcgccgtc
ttcaaagaagtagcagcaaaacaagatatcaaattgacttaccttgcttatgttgctaaa
gccttggcaactactgctcataagttcccagaaattaatgcttctgttgactatgataag
caagaaattgtttatcatgaacatgtcaacctcgggattgctgtaaatgccccaactggt
ttatatgtcccagtcattcatgaagctgaaactaaatcaatccttgaaattgcaaaagaa
attgctgaattagcgactgctacacgtgaaggaacgcttaaacctcaacaaatgcaaggc
tcaacgattacaatttcaaatattggttctgctcgtggttcttggtttacaccaatcatc
aacggttctgatgttgtgattttaggtttgggttcaattgttaaagaaccaattgtcaat
ggtgaaggtgaaattgtcgtaggacaaaacatgaaattgtctatgacttatgaccaccgt
ttgattgatggtatgttgggtcaaacatcacttaactacttgaaatcacttttggctgac
cctgagttcatgcttatggaaatttaa

DBGET integrated database retrieval system