KEGG   Lactococcus lactis subsp. cremoris A76: llh_0905Help
Entry
llh_0905          CDS       T01965                                 

Definition
1,4-alpha-glucan (glycogen) branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:llr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(171518..173461)
Genome map
AA seq 647 aa AA seqDB search
MPLNILDYDPYLEPFKDDLSLRLFEFARTKKRLLGVDGSLVDFANGYKYFGFQQESKHWT
FREWAPNAKKAWLVGDFNNWENNYELKQAYGGTWEISVPGLLPVGSKVKIKLLLPTGEVV
YRVPSYIMYALPNENHGLDGVITQPKYEWKNKSPNLSEAPLIYEAHIGISTEEYKINSYK
EFTRDVLPRIKKDGYNTIQLMAIMEHPLYASFGYQVSNFFAISSRFGQPEDLMELIDKAH
GLDLQVLLDVVHSHAVKNIEDGLNYFDGKENQYFHEGERGNHPAWKTKLFNYGKDEVLHF
LLSNLKFWLDIYHFDGFRFDGVTSMLYHDHGLGTAFTDYSKYFSLNTDVEAVTYLMLANE
LTHLFNPSATTIAEDMSAMPGMALPISAGGIGFDYRLSMGIPDFWIKQLKEKTDNSLDLL
SLWWELTTRRPGEKNIGYSESHDQALVGDKTLMMWLANEEIYWNMDINSQSLIIDRAIAL
HKLIRLITFSLAGEGYLNFMGNEFGHPEWLDFPREENHDDFQHARRQWSLADNENLRFKY
LLAFDQAMLNLEHDFKFLESTDPVQQLWIKDSDKLLAYKKGQLVFVFNFHPSYEQKLQLQ
FSKKPELIFDSDDQKFGGFGPRSSFGWSKGTLNLILEPRTAMVFKIK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaatatcttggattatgacccctatttggaacctttcaaagatgacttgtct
ttacgcctctttgaatttgctagaactaagaaacggcttttgggcgttgatggttcttta
gttgattttgcgaacggctataagtattttggcttccaacaagaaagtaaacactggact
ttccgcgaatgggcaccaaatgctaaaaaagcttggcttgttggtgactttaacaattgg
gaaaacaactatgaactaaaacaggcttatggcgggacttgggaaatttcagttcctgga
ttattacctgtaggttctaaagtaaaaataaagttgcttttgccaactggagaagttgtt
tatcgtgttccttcttacattatgtatgctcttcctaatgaaaatcatggtttagacggg
gttattactcagcctaagtacgaatggaaaaataaaagccctaacctaagcgaagcacct
ttgatttatgaggcacatattgggatttcaaccgaagaatacaaaattaattcttacaaa
gaattcacgcgcgatgttttacccagaattaaaaaagatggttacaataccattcagctg
atggcaattatggaacacccgctctatgctagttttggttatcaagtttccaattttttt
gccatctctagtcgatttggtcagccagaagatttaatggaattgattgataaggcacat
ggtttggatttgcaagtgcttttagacgtggttcattcacatgctgtaaaaaatattgag
gatgggctcaactattttgatggaaaagaaaatcagtattttcatgaaggcgaacgggga
aatcatccagcttggaagacgaaactttttaattatggcaaagatgaagtccttcatttt
ttactatcaaatctaaaattttggctagacatttatcatttcgatggctttcgttttgat
ggagtaacttcaatgctttatcatgaccatggtttaggaactgcttttacagattatagt
aagtatttttcacttaatacggatgttgaagccgtgacatatttgatgctggctaatgaa
ctaactcatctctttaatccatcagcaacaacaatcgctgaagacatgtctgccatgcct
gggatggcactacctatctcggctggcggaattggttttgattatcgtttgtcaatggga
attcctgatttttggattaaacaattgaaagaaaaaacagataatagtttagatttgcta
agtttatggtgggaattgacgaccagacgacctggagaaaaaaatatcggttattcagaa
agtcatgatcaagctttagttggagataaaacactgatgatgtggctagctaatgaagaa
atctattggaacatggacatcaatagtcaatctctgattattgaccgtgccattgccctc
cataagttaattcgattgattactttcagtctagcaggtgaaggttatttaaatttcatg
ggaaacgaatttggtcatcctgaatggctcgatttccctcgagaagaaaatcatgatgat
tttcaacatgctagaagacaatggtcacttgctgataacgaaaatttacgtttcaaatat
ttactggcatttgaccaagccatgctcaatttagaacatgatttcaaatttttagaaagt
acagatcctgttcaacagctttggattaaggattcggataaattactggcatacaaaaaa
ggacaattagtttttgtctttaatttccaccctagttatgagcaaaaacttcagctccaa
ttttctaaaaaaccagaacttatctttgacagtgatgatcaaaaattcgggggatttggt
ccccgaagtagttttggttggtcaaaaggaactttaaatttgattcttgaacctagaaca
gcgatggtgtttaaaattaaatag

DBGET integrated database retrieval system