KEGG   Lactococcus lactis subsp. cremoris A76: llh_1115Help
Entry
llh_1115          CDS       T01965                                 

Definition
Beta-glucosidase, 6-phospho-beta-glucosidase (EC:3.2.1.21 3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:llr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213342..214778
Genome map
AA seq 478 aa AA seqDB search
MEHKKLSSFPSDFLWGSASAAYQVEGAPFEDGKKASVWDNFVCIPGKTFKGTNGDVAVDH
YHRYKEDVALMKELGLKSYRFSIAWTRILPDGRGEVNQAGLKFYEDLIDELIANHIEPIV
TIYHWDLPQALEDLYGGWESREIIADFVNYAEVLFKAFKGKVKYWVSLNEQNIFTSQGWS
LATHPPGKRDMKLFYQVNHIANLANAAVINKFHELEMDGQIGPSFAYTPQYAKDSDPLNV
LAAENAEELYSHFWMDVYLYGEYPIAAMAYLRENGLAPEFEAGDAELLKSAKPDFLGINY
YQTATNAWNPIDGGIGVGSFNTSGKKGTTKESGIPGLHKKIQNPFIDRTNWDWEIDPEGL
RIALRRITSRYRIPIMITENGLGEYDKVEEGKIHDDYRIKYLESHVKAIKEAMTDGATVI
GYHTWSYTDLLSWLNGYQKRYGFVYVDQDETMEGSLKRIPKDSYYWYQHLIETNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaaaaaattgagctcatttccaagtgattttctttggggttcagcttcagca
gcttatcaagttgaaggagcaccttttgaagatggtaaaaaagcgagtgtctgggataac
tttgtctgcattccgggtaaaacttttaaagggacaaacggggatgttgctgttgatcat
taccatcgttacaaagaagatgtcgctttgatgaaagaattaggacttaaatcttaccgc
ttttcgattgcttggacacgtattttacctgacgggcgtggcgaagtcaatcaagcgggc
ttgaaattctatgaagacttgattgatgagttaattgctaatcatattgaaccaattgtc
acgatttatcattgggacttgccccaagctttagaagacctgtatggcggttgggaatca
cgagaaattatcgcagactttgttaactatgctgaagttttatttaaagcctttaaaggt
aaagtaaaatattgggtatcgcttaatgaacaaaatatctttacaagtcaaggttggtca
ctcgcgactcacccaccagggaaaagagatatgaagctcttttatcaggtcaatcatatc
gcgaatttggcaaatgctgcggtaattaataagtttcatgagcttgaaatggatggacaa
attggcccttcattcgcctatacaccacagtatgctaaggattctgaccctttaaatgtt
ttggctgctgagaacgctgaagaactttatagtcacttttggatggatgtttacctttat
ggtgaatacccaattgcagcaatggcttatctgcgggaaaatggtttagcacctgaattt
gaagcaggagatgctgaactcttgaagtcggccaaacctgattttctaggcattaattac
taccaaacggcgactaacgcttggaatccaattgatggtgggattggagttggttcattt
aatacaagcggtaaaaaaggaacaaccaaagaatcaggaattcctgggcttcataaaaaa
attcaaaatccattcattgaccgcacaaattgggattgggaaattgacccagaaggtttg
cgaattgcactccgtcgaattacttcacgctatcgtattccgatcatgattacggaaaat
ggtttgggtgaatatgacaaagttgaagagggcaaaattcatgacgattaccgaattaaa
tatctagaaagtcatgttaaggcaatcaaagaagccatgactgacggtgctacggtcatt
ggttatcacacttggtcttatactgacttactttcatggttgaacggttatcaaaaacgt
tatggttttgtttatgttgaccaagacgaaacaatggaaggttccttgaaacgaattcct
aaggattcttattactggtatcaacatcttattgaaacaaatggcgaagagctctaa

DBGET integrated database retrieval system