KEGG   Lactococcus lactis subsp. cremoris A76: llh_12220Help
Entry
llh_12220         CDS       T01965                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00260  Glycine, serine and threonine metabolism
llr00750  Vitamin B6 metabolism
llr01100  Metabolic pathways
llr01110  Biosynthesis of secondary metabolites
llr01120  Microbial metabolism in diverse environments
llr01230  Biosynthesis of amino acids
Module
llr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llh_12220
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    llh_12220
Enzymes [BR:llr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     llh_12220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEU41620
UniProt: G8P2J1
Position
complement(2242458..2243948)
Genome map
AA seq 496 aa AA seqDB search
MVTFYQSTRDKSNKKTASQAILQGLAEDGGLFVPVDFPKVDLDFEKLKNASYQEIAELVL
KAFFDDFSADEIKSMVTKAYGEKFDSPEIAPLKRLGNHYILELFHGETIAFKDMALSILP
HLMTQAAKKNGVTNEIVILTATSGDTGKAAMAGFADVPQTKIIVFYPKGGVSHIQEQQML
TQKGANVHVVGIDGNFDQAQTAVKEMFNNKVLHDQLLKNNKQFSSANSMNIGRLIPQVAY
YIYAYAQLVKTGQITDGEKINFSVPTGNFGNILAAYYAKKLGLPVHQLICASNKNNVLTD
FFKTGLYDKNREFYVTSSPSMDILVSSNLERLIFDLTDENDDETLALLTALSAEGHYQIS
KKMMSKLQGFIADWASEEEISQEINETFENENYVLDPHTAVANYVYHQIQPKEKTVVVST
ASPYKFPKVVLEGLQKSGTGLSEKIDDFAAVKSLEKLSGIPLPKAVLGLEKAEILHHTVV
PVQEMQKEVEKYLGLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtaactttttatcaatcaacacgggataaatcaaataaaaaaacagcctcacaagct
atcttgcaaggtttggcagaagacggtggactttttgttcctgttgacttcccaaaagtt
gatttagactttgaaaaattaaaaaacgcttcttatcaagaaattgctgaacttgttttg
aaagcattttttgatgatttttctgctgacgaaattaaatcaatggttacaaaagcatac
ggagaaaaattcgatagtccggaaattgcaccgcttaaaagacttgggaatcactatatt
cttgaactttttcatggtgaaacgattgcttttaaagacatggcactctctatcttacct
catttaatgacccaagcggctaagaaaaatggtgtgaccaatgaaattgttatcttgact
gcaacttctggagatacaggaaaagccgcaatggctggttttgctgatgtgccccaaaca
aaaattattgttttttatcccaaaggtggtgtcagccatattcaagagcaacaaatgctg
acccaaaaaggggctaatgttcacgttgttggaattgatggaaattttgaccaagctcaa
acagcagtaaaagaaatgtttaataacaaagttttacatgatcaacttttgaaaaataat
aaacaattttcgtcagcaaattcaatgaatattggacgtttgattccgcaagtcgcttat
tatatttatgcttacgcacaactggtcaaaactggtcaaattactgacggagaaaaaatc
aatttttcagttccgacaggaaattttggaaatattttagccgcttattatgctaaaaaa
ttgggcttgcccgttcatcagctcatctgtgcttcaaataaaaataatgtgctgacagac
tttttcaaaacaggactttatgataaaaatcgagaattttatgtgacaagttcaccgtca
atggatattttggtttcttcaaatcttgaacgattgatttttgatttaactgacgagaat
gatgatgagactttggctttactgacagctttgtcagcagaaggtcattatcaaatttct
aaaaaaatgatgagtaagttacaaggttttatagctgactgggcatcagaagaagaaatt
tcccaagaaattaatgaaacttttgaaaatgaaaactatgttcttgacccccacacagcg
gttgcaaactatgtctatcatcaaattcaaccaaaagaaaaaacagttgttgtcagcact
gccagcccttataagttccctaaagttgttttagaaggacttcaaaagtcaggaacgggc
ttgtcagagaagatagatgattttgctgccgttaaatcacttgaaaaactcagtggtatt
ccattacccaaagctgtgttagggcttgaaaaagctgaaattttgcatcatacagtagtt
ccagttcaggaaatgcaaaaagaagtagagaaataccttggtttaaaatga

DBGET integrated database retrieval system