KEGG   Lactococcus lactis subsp. cremoris A76: llh_12485Help
Entry
llh_12485         CDS       T01965                                 

Definition
Alcohol dehydrogenase, Acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    llh_12485
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llh_12485
   00620 Pyruvate metabolism
    llh_12485
   00650 Butanoate metabolism
    llh_12485
  Lipid metabolism
   00071 Fatty acid degradation
    llh_12485
  Amino acid metabolism
   00350 Tyrosine metabolism
    llh_12485
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    llh_12485
   00626 Naphthalene degradation
    llh_12485
Enzymes [BR:llr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     llh_12485
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     llh_12485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2299739..2302225
Genome map
AA seq 828 aa AA seqDB search
MKLAVGVVEDKDTKNHFASESVYNAIKNDKTVGVIAENKVAGSVEIASPLGVLAGIVPTT
NPTSTAIFKSLLAAKTRNAIVFAFHPQAQKCSSHAAKIVYDAAIEAGAPEDFIQWIEVPS
LDMTTALIQNRGIATILATGGPGMVNAALKSGNPSLGVGAGNGAVYVDATANIDRAVEDL
LLSKRFDNGMICATENSAVIDASIYDEFVAKMQAQGAYMVPKKDYKAIESFVFVERAGEG
FGVTGPVAGRSGQWIAEQAGVNVPKDKDVLLFELDKKNIGEALSSEKLSPLLSIYKSETR
EEGIEIVRSLLAYQGAGHNAAIQIGAMDDPFVKEYGIKVEASRILVNQPDSIGGVGDIYT
DAMRPSLTLGTGSWGKNSLSHNLSTYDLLNVKTVAKRRNRPQWVRLPKEIYYEKNAISYL
QELPHVHKAFIVADPGMVKFGFVDKVLEQLAIRPTQVETSIYGSVQPDPTLSEAIAIARQ
MTQFEPDTVICLGGGSALDAGKIGRLIYEYDARGEADLSDDASLKELFQELAQKFVDIRK
RIIKFYHPHKAQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLADYQLTPQVAIVDPEFV
MTVPKRTVSWSGIDAMSHALESYVSVMSSDYTKPISLQAIKLIFENLTESYHYDPAHPTK
EGQKARENMHNAATLAGMAFANAFLGINHSLAHKIGGEFGLPHGLAIAIAMPHVIKFNAV
TGNVKRTPYPRYETYRAQEDYAEISRSMGFAGKEDSDEKAAKALVAELKKLTDSIDINIT
LSGNGVDKAHLERELDKLADLVYDDQCTPANPRQPRIDEIKQLLLDQY
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggccgtgggagttgttgaggacaaagatacaaaaaaccatttcgcttctgaa
tctgtttataatgcaatcaaaaatgataaaacagttggcgttatcgctgaaaacaaagtt
gctggttctgttgaaatcgcaagcccccttggagtacttgctggtattgtcccaacaact
aatccaacatcaacagccatctttaaatctttattggctgcaaagactcgtaatgctatt
gtctttgcctttcacccacaagcacaaaaatgctcaagccatgcagctaaaattgtttat
gatgctgcgattgaagctggtgcacccgaagacttcattcaatggattgaagtacccagt
cttgatatgacgactgctttgattcaaaatagaggaattgctacaattcttgcaactggt
ggtccaggtatggtcaatgctgcgcttaagtctggtaatccttcacttggtgtaggtgct
ggtaacggtgcagtatacgttgatgcaactgcaaatatcgatcgtgctgttgaagatctc
ttgctttcaaaacgttttgataacggaatgatttgtgcgactgaaaactctgcagttatt
gatgcatcaatctatgatgaatttgtcgctaaaatgcaagcccaaggcgcttatatggtt
cctaaaaaagattacaaggcaattgaaagttttgttttcgttgaacgtgctggtgaaggt
tttggtgtaactggtcctgttgctggtcgttctggtcaatggattgctgaacaagctggt
gttaacgtccctaaagataaagatgttcttctttttgaacttgataagaaaaatattggg
gaagctctttcttctgaaaaactttctcctttgctttcaatctacaaatcagaaacacgt
gaagaaggaattgaaattgtacgtagcttacttgcttaccaaggagctggtcacaacgct
gccattcaaatcggtgcaatggacgacccatttgtcaaagaatacggaattaaagtcgaa
gcttctcgtatcctcgttaaccaacctgactctatcggtggggtcggagatatttatact
gatgcaatgcgtccatcattgacgctcggaactggttcatgggggaaaaattcactttca
cacaatttgagtacatacgatctattgaatgttaaaacagtggctaaacgtcgtaatcgc
cctcaatgggttcgtttgccaaaagaaatttactacgaaaaaaatgcaatttcttactta
caagaattgccacacgtccacaaagctttcattgttgccgaccctggtatggttaaattc
ggtttcgttgataaagttttggaacaacttgctatccgcccaactcaagttgaaacaagc
atttatggctcagtccaacctgacccaactttgagcgaagccattgcaatcgctcgtcaa
atgacacaatttgaacctgacactgtcatctgtcttggtggtggctctgcccttgatgct
ggtaagattggacgtttgatttatgaatatgatgctcgtggtgaggctgacctttccgat
gacgcaagtttgaaagagctcttccaagagttagctcaaaaatttgttgatattcgtaaa
cgtattatcaaattctaccacccacacaaagcacaaatggttgctatccctactacttct
ggtactggttctgaagtgactccatttgcggttatcactgatgatgaaactcacgttaaa
tatccacttgctgactatcaattgacacctcaagttgccattgttgatcctgagtttgtt
atgactgtaccaaaacgtactgtttcttggtctgggattgatgccatgtcacacgcgctt
gaatcttatgtttctgtcatgtcttctgactatacaaaaccaatatcacttcaagccatc
aaacttatctttgaaaacttgactgagtcttatcactatgacccagctcatccaaccaaa
gaaggtcaaaaagctcgcgaaaacatgcacaatgctgcaacactcgctggtatggccttc
gccaatgctttccttggaattaaccactcacttgctcataaaattggtggtgaatttgga
cttcctcatggtcttgccattgctatcgctatgccacatgtcattaaatttaacgctgta
acaggaaacgttaaacgtaccccttacccacgttatgaaacttatcgtgcgcaagaagac
tacgctgaaatttcacgctccatgggatttgctggcaaagaagattcagatgaaaaagcg
gccaaagctttggttgctgaacttaaaaaattgactgatagtattgatattaatatcacc
ctttcaggaaatggtgtagataaagctcatcttgaacgtgagcttgataaattggctgac
cttgtttatgatgaccaatgtacacctgctaatccacgtcaaccaagaattgatgagatt
aaacaactcttgttagaccaatattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system