KEGG   Lactococcus lactis subsp. cremoris A76: llh_12885Help
Entry
llh_12885         CDS       T01965                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:llr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    llh_12885
Enzymes [BR:llr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     llh_12885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2373389..2373640)
Genome map
AA seq 83 aa AA seqDB search
MGKKTAMQMVLDLAGKFDATGAVGIPLLDAAPAGNLALEEAIEALQALGYKATELKKIEK
KLEQEAGLTSEEYIKSALKLMMK
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaaaaaacggccatgcaaatggtgctcgatttagctgggaaatttgatgcgaca
ggagctgttgggattccccttcttgatgctgcgcctgctggtaatctggctttagaagaa
gccattgaagctttgcaagctttgggctataaggcgacagaactcaagaaaattgagaaa
aaattggagcaagaagccggattaaccagtgaagaatatatcaaatcagccttaaaactt
atgatgaaataa

DBGET integrated database retrieval system