KEGG   Lactococcus lactis subsp. cremoris A76: llh_1515Help
Entry
llh_1515          CDS       T01965                                 

Definition
Fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:llr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:llr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:llr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:llr00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:llr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288438..290360
Genome map
AA seq 640 aa AA seqDB search
MDKKYYQLLKKQFSSKEAVLTEIINLSAICELPKATEHFMSDVHGEYDAFNHVLRNGSGS
IKEKLRDCFPQFSSAEISSVATLIYYPQEKLDSECQLQDKKLFEHYCRLNLVYLLKTVKF
VGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKQDYFDSILSQLQNLGELTRLIVALA
DTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLINMPSVDVQWGNHDIVWMAAFSGSLLAMM
NVIRICARYGNLDILEESYGINLRAILEYAERYYEPSEAFRPRLVDGVRLSADEKALLNK
LQQATAILQFKLESQLIERRPDFQLEHRDLLHFIDFSQNKIELAGETYDLIDFQAPTINP
EQPASLTEEEEKIIAHLLNNLKTSDKLKRHVGFLQEKGAMYLSYNGNLLIHGCLPLHENG
DFKSFTIDKKAYAGRDLLDFFDSEVRKCLAHPEESEDLATDLMWYLWVGECSSLFGKTAM
TTFERYYIKDKSTHVEKKNPYYQLREQPKIITKILENFGLDENGHLVNGHTPIKEKNGEN
PIKADGKLIVIDGGFAKAYQKETGIAGYTLLYNSFGIQLVAHQPFSTVKAAVEKGTDIIS
LKHLVAEVDERKRVKDTNVGQTLLSEIADLEVLFEHYEDY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatattatcagttattaaaaaagcagttttcttcaaaggaggctgtactt
acagaaattattaatttgagtgcaatttgtgaattaccaaaagcaacagagcattttatg
agtgatgtgcatggtgaatatgatgcttttaatcatgtcctaagaaatggttccggcagt
atcaaagaaaaattacgggattgttttccacaattttcgtcagcagaaatttcatcagtg
gcaaccttgatttattatccacaagaaaaactagactctgaatgtcaacttcaagataaa
aagctttttgagcactattgccgtctaaacctagtctatctattgaaaacagttaaattt
gttggacaaaaatatacgcgttcaaaagttcgtaaagcttttccagaaaaatttcgctac
atcttagaagagttaatcaatgaagtggattcgacgactgacaaacaggactattttgat
tcaattctttcgcaactacaaaatctgggagaacttactcgcttaattgttgcacttgca
gatacaattcgcagattgacggtcgaccatctacatgttgttggggatatttatgatcgc
ggaccatatccagacaaaattattgatcgtttgataaacatgccctcagttgatgttcag
tggggcaatcatgatattgtgtggatggcggcttttagtggctcacttttggccatgatg
aatgtgataagaatttgtgcccgttacgggaatttagatattcttgaagaatcttatggg
attaatttgcgtgctattttagaatatgctgaacgttattatgaaccaagtgaggcattt
cgtccacgattagttgatggggttcgcttgtcagctgatgaaaaagcactccttaataaa
ttacagcaagccacggctattttacaatttaagttagaaagtcaactaattgaaagacgg
ccagatttccaacttgaacatcgggacctcctccattttattgatttctcacaaaataaa
atagaattagcaggtgaaacttatgatttaattgattttcaggcgcctacaattaatcct
gaacagcccgcaagtctaactgaggaagaagaaaaaataattgctcacttgttaaataat
ttaaaaacttcagataagctcaagcgccatgttggattcttgcaagaaaaaggggccatg
tatctttcttacaatggcaatctattgattcatggttgccttcccttacatgaaaatgga
gattttaaatcatttacgattgataagaaggcttatgctggacgagatttacttgatttt
tttgacagtgaggttagaaaatgtcttgctcatcctgaagaatcagaggatttagcaact
gatttgatgtggtacttatgggtgggagaatgttcttccttgtttggcaaaacagcaatg
acaacctttgaacgttattatatcaaggataaatccactcatgtagaaaagaaaaatcca
tattatcaattacgtgaacaacctaaaatcattacaaaaatcttagaaaactttggttta
gatgaaaatggacatttggttaatggtcacactccaattaaggaaaaaaatggcgagaat
ccaatcaaggcggatggaaagttgattgtgattgatggaggttttgctaaagcctatcaa
aaagaaacaggtatcgctgggtatactcttctttacaatagttttggcattcaattggtt
gctcaccaacctttttcgacagtcaaagcagcggtcgaaaaaggaacagatattattagc
ttgaaacatttagtggcggaagttgacgaacgaaagcgggtcaaagatactaatgttggg
caaactttgctaagtgaaatagcagatttagaggtgctttttgagcattatgaagattat
taa

DBGET integrated database retrieval system