KEGG   Lactococcus lactis subsp. cremoris A76: llh_1515Help
Entry
llh_1515          CDS       T01965                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00010  Glycolysis / Gluconeogenesis
llr00030  Pentose phosphate pathway
llr00051  Fructose and mannose metabolism
llr00680  Methane metabolism
llr01100  Metabolic pathways
llr01110  Biosynthesis of secondary metabolites
llr01120  Microbial metabolism in diverse environments
llr01130  Biosynthesis of antibiotics
llr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llh_1515
   00030 Pentose phosphate pathway
    llh_1515
   00051 Fructose and mannose metabolism
    llh_1515
  Energy metabolism
   00680 Methane metabolism
    llh_1515
Enzymes [BR:llr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     llh_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos DRE2_N Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AEU39479
UniProt: G8P4W7
Position
288438..290360
Genome map
AA seq 640 aa AA seqDB search
MDKKYYQLLKKQFSSKEAVLTEIINLSAICELPKATEHFMSDVHGEYDAFNHVLRNGSGS
IKEKLRDCFPQFSSAEISSVATLIYYPQEKLDSECQLQDKKLFEHYCRLNLVYLLKTVKF
VGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKQDYFDSILSQLQNLGELTRLIVALA
DTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLINMPSVDVQWGNHDIVWMAAFSGSLLAMM
NVIRICARYGNLDILEESYGINLRAILEYAERYYEPSEAFRPRLVDGVRLSADEKALLNK
LQQATAILQFKLESQLIERRPDFQLEHRDLLHFIDFSQNKIELAGETYDLIDFQAPTINP
EQPASLTEEEEKIIAHLLNNLKTSDKLKRHVGFLQEKGAMYLSYNGNLLIHGCLPLHENG
DFKSFTIDKKAYAGRDLLDFFDSEVRKCLAHPEESEDLATDLMWYLWVGECSSLFGKTAM
TTFERYYIKDKSTHVEKKNPYYQLREQPKIITKILENFGLDENGHLVNGHTPIKEKNGEN
PIKADGKLIVIDGGFAKAYQKETGIAGYTLLYNSFGIQLVAHQPFSTVKAAVEKGTDIIS
LKHLVAEVDERKRVKDTNVGQTLLSEIADLEVLFEHYEDY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatattatcagttattaaaaaagcagttttcttcaaaggaggctgtactt
acagaaattattaatttgagtgcaatttgtgaattaccaaaagcaacagagcattttatg
agtgatgtgcatggtgaatatgatgcttttaatcatgtcctaagaaatggttccggcagt
atcaaagaaaaattacgggattgttttccacaattttcgtcagcagaaatttcatcagtg
gcaaccttgatttattatccacaagaaaaactagactctgaatgtcaacttcaagataaa
aagctttttgagcactattgccgtctaaacctagtctatctattgaaaacagttaaattt
gttggacaaaaatatacgcgttcaaaagttcgtaaagcttttccagaaaaatttcgctac
atcttagaagagttaatcaatgaagtggattcgacgactgacaaacaggactattttgat
tcaattctttcgcaactacaaaatctgggagaacttactcgcttaattgttgcacttgca
gatacaattcgcagattgacggtcgaccatctacatgttgttggggatatttatgatcgc
ggaccatatccagacaaaattattgatcgtttgataaacatgccctcagttgatgttcag
tggggcaatcatgatattgtgtggatggcggcttttagtggctcacttttggccatgatg
aatgtgataagaatttgtgcccgttacgggaatttagatattcttgaagaatcttatggg
attaatttgcgtgctattttagaatatgctgaacgttattatgaaccaagtgaggcattt
cgtccacgattagttgatggggttcgcttgtcagctgatgaaaaagcactccttaataaa
ttacagcaagccacggctattttacaatttaagttagaaagtcaactaattgaaagacgg
ccagatttccaacttgaacatcgggacctcctccattttattgatttctcacaaaataaa
atagaattagcaggtgaaacttatgatttaattgattttcaggcgcctacaattaatcct
gaacagcccgcaagtctaactgaggaagaagaaaaaataattgctcacttgttaaataat
ttaaaaacttcagataagctcaagcgccatgttggattcttgcaagaaaaaggggccatg
tatctttcttacaatggcaatctattgattcatggttgccttcccttacatgaaaatgga
gattttaaatcatttacgattgataagaaggcttatgctggacgagatttacttgatttt
tttgacagtgaggttagaaaatgtcttgctcatcctgaagaatcagaggatttagcaact
gatttgatgtggtacttatgggtgggagaatgttcttccttgtttggcaaaacagcaatg
acaacctttgaacgttattatatcaaggataaatccactcatgtagaaaagaaaaatcca
tattatcaattacgtgaacaacctaaaatcattacaaaaatcttagaaaactttggttta
gatgaaaatggacatttggttaatggtcacactccaattaaggaaaaaaatggcgagaat
ccaatcaaggcggatggaaagttgattgtgattgatggaggttttgctaaagcctatcaa
aaagaaacaggtatcgctgggtatactcttctttacaatagttttggcattcaattggtt
gctcaccaacctttttcgacagtcaaagcagcggtcgaaaaaggaacagatattattagc
ttgaaacatttagtggcggaagttgacgaacgaaagcgggtcaaagatactaatgttggg
caaactttgctaagtgaaatagcagatttagaggtgctttttgagcattatgaagattat
taa

DBGET integrated database retrieval system