KEGG   Lactococcus lactis subsp. cremoris A76: llh_1805Help
Entry
llh_1805          CDS       T01965                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:llr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:llr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
346663..347943
Genome map
AA seq 426 aa AA seqDB search
MKKIVINGGKRISGTIPISGAKNSVVALIPATILANDIVTLEGVPDISDVASLVEIMEIT
GAKIERNLEEGRLVIDTRSVVSRSVVSRPLPYGKINSLRASYYFNGALLGRFGQATVGLP
GGCDLGPRPTDLHDKAFKALGAKKIQEEEAEHLEVIGDSLVGTTIYMDVVSVGATINTML
AASRAKGVTVIENAAREPEIIDVATLLNNMGAKVRGAGTDIIRITGIDEMHGAQHTVIPD
RIEAGTYLALAAAMGDGVIIENVIYEHLESFIAKLEEMGVRLTIREDSIEVHKSENLKSV
NITSVPYPGFATDLQQPITPLLLKAKGRGSIVDTIYQKRVNHVPELARMGANISVLDDRI
IYDAPNELTGSCVQATDLRAGAGLVTAGIIASGTTKISNIEFILRGYDHIIEKLTAVGVD
IQLIEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagtaattaatggtgggaagcgtatctctggaacaattccaatttctgga
gcaaaaaattcagtggttgctttaattcctgcaaccattctagctaacgatattgttact
ctggaaggagttccagatatttctgatgtcgcaagtttagtcgaaattatggaaatcacg
ggagcaaaaattgagcgaaatcttgaagaaggtcgacttgtgattgatacacgtagtgtc
gtttcacgtagtgtcgtttcacgtcctctgccttatggaaagattaattctttgcgtgct
tcttattattttaatggtgcacttttgggtcgttttggacaagcgacagttggcttgcct
ggaggctgtgatttaggtcctcgtccaaccgatttacatgataaagcctttaaagcttta
ggggctaagaagattcaagaagaagaagctgagcacttagaagtgattggtgattcatta
gttggaacaaccatttatatggacgttgtttccgttggagcaaccatcaatacgatgctt
gctgctagtcgtgcaaaaggtgtaactgtaattgaaaatgctgcacgtgagcctgaaatt
attgatgtggcaacccttcttaataacatgggggcaaaagttcgtggtgcaggaacagat
attatccgtatcactgggatagatgaaatgcacggagctcaacatacggtaattcctgac
cgaattgaggctggaacttaccttgctttagctgctgcgatgggtgatggggttattatt
gaaaatgtcatctatgaacatttggaatctttcattgctaaacttgaagaaatgggcgta
cgtttgacgattcgtgaagacagcattgaagttcataaatctgaaaatttaaaatcagtt
aatattacctctgttccttacccaggatttgcgactgatttgcaacaaccaattacgcca
ctgttgttaaaagcaaaaggtcgtggttcgattgttgatacgatttatcaaaaacgtgtt
aaccacgtacctgaattagcgcgtatgggtgctaatatttctgttttggatgatagaatt
atttatgacgctccgaatgagttaactggaagctgtgttcaagcaacagatttacgtgct
ggtgcgggtctggttactgctggaattattgccagtggaactacaaaaatttctaatatt
gagtttatcctacgaggctatgatcatatcattgaaaaattgactgctgttggtgtagat
attcaattgattgaagagtga

DBGET integrated database retrieval system