KEGG   Lactococcus lactis subsp. cremoris A76: llh_1975Help
Entry
llh_1975          CDS       T01965                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llh_1975
   01230 Biosynthesis of amino acids
    llh_1975
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llh_1975
  Energy metabolism
   00680 Methane metabolism
    llh_1975
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llh_1975
Enzymes [BR:llr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     llh_1975
Exosome [BR:llr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   llh_1975
  Exosomal proteins of melanoma cells
   llh_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374255..374956
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEFSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcatacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgctcttgaattttcagatcaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccacctgcaatggatcatgatgataaatatacagctcacggagaccgtcgttatgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgcgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaattcgcgccctcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaatttg
aacgttcaaaacgaatactatttggctccaaaaaaagcttaa

DBGET integrated database retrieval system